KEGG   Acidaminococcus fermentans: Acfer_1420Help
Entry
Acfer_1420        CDS       T01151                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00230  Purine metabolism
afn01100  Metabolic pathways
Module
afn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Acfer_1420
Enzymes [BR:afn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Acfer_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_17 Thymidylate_kin ADK AAA_22 RsgA_GTPase AAA_16 AAA_30 Cytidylate_kin MMR_HSR1 ABC_tran AAA_29
Motif
Other DBs
NCBI-ProteinID: ADB47779
JGI: Acfer_1420
UniProt: D2RL27
Position
complement(1570343..1570987)
Genome map
AA seq 214 aa AA seqDB search
MNKPQGILLVLSGPSGAGKGTICARLREKRDHMAYSVSCTTRQPRNGEVDGVNYFFKTRD
EFEEMIKNGGLLEHASVYGNYYGTPRQYVLDKLAEGLDVILEIDPQGALQVKKSYPDGVF
VFIVPPSLDELSKRIYKRGTDAVDVIKRRLSAATSELAYASKYDYIVVNDEVEKATDKVS
KIIDVEHLRVGRTYYIVDEICHNGTCDCGEPQKK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacctcagggaatcttgctggtgctcagcggccccagcggtgccggcaaaggc
accatctgcgcccggctccgggaaaaacgggaccacatggcctactcggtgtcctgcacc
acccgccagccccggaacggggaagtggacggggtgaactatttcttcaagacccgggat
gagttcgaagaaatgatcaaaaacggaggcctgctggaacacgcttccgtatacgggaac
tattacggcaccccccggcagtatgtgctggacaaactggcggaagggctggacgtgatc
ctggaaatcgacccccagggggccctccaggtgaagaaaagctatcccgacggggtgttc
gtgtttatcgtgcctccttccctggatgaactgtccaaacgaatctacaaacggggcacc
gacgcggtggacgtgatcaaacgccggctcagcgctgccaccagcgaactggcctatgcg
tccaagtatgactacatcgtggtcaacgacgaagtggaaaaagctaccgacaaggtaagc
aagatcatcgatgtggaacacctgcgggtgggtcgcacctactatattgttgatgaaatc
tgccacaacggcacctgtgactgcggcgaaccgcagaagaagtaa

DBGET integrated database retrieval system