KEGG   Acidaminococcus fermentans: Acfer_1467Help
Entry
Acfer_1467        CDS       T01151                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
afn  Acidaminococcus fermentans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:afn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Acfer_1467
Enzymes [BR:afn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Acfer_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1624953..1627118)
Genome map
AA seq 721 aa AA seqDB search
MAESVTIEITVKNIVFQADTGTFSVFRGENPEVGTISIVYRGQAPYAGEQIRLAGIWGDH
PRFGRQFQAQSWEAVQPRGAEGLVRMLGSGVLKGVGPAMAQRIVDQFGEDTLEVLEKFPE
RLREVSGIGKKKAEAIITSYGELRENRELVFFLESHGISGNFAPRIQALYGSTAVTRISN
NPYCLAEDVEGIGFRTADALARNLGMDEHGDERIRAGIHYTLLQGAGQGHTCVPDSWLVG
NAARVLQVDPLEVRQVFDQLLRDNLLRAEDRGDHVCVYPEYLYRAEEGVAHRLLALRDNV
NALWKVDYQKIIREWERDERIRLAPEQAEAVKASVDHGVFVLTGGPGTGKTTVVKGILSV
MEQAGCKILLAAPTGRAAKRLSESAGKPALTVHRLLEYTPNGEGDSFWGRNEDNPLEADA
VIVDEASMMDIVLMYNLLKALPLGCRLILVGDVDQLPSVGPGSVLQDIIRSGTMPIVRLE
NVFRQAELSPIVRNAHRINQGLMPQWEGEKDFRFREFATEEETMHYIVDLYVHLAARQPQ
DAIQVLTPMHKNLCGVENLNNMLQARMNPPSPEKQEYRGSFLLLREGDKVMQIRNNYDKN
VFNGDIGRICSIQGAHVTVDFPDRAEGEAVTYEGAEVSDLRLAYAMSVHKSQGSEYAVVL
MPLVLSHYILLQRNLFYTAITRAKKQVYLAGSRRALRTAVENDRTRKRYSLLAERLKRYG
E
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggccgaatccgttaccatcgaaatcactgtcaaaaacatcgtcttccaggcagacaca
ggcaccttcagtgtctttcggggcgagaacccggaagtggggaccatttccatcgtctac
cgggggcaggcgccttatgcgggagagcagatccggctggccgggatctggggggaccat
ccccggttcggccggcagttccaggcccagagctgggaagccgtccagcccaggggggcg
gaaggcctggtgcggatgctgggcagcggagtgctcaagggagtgggcccggccatggcc
cagcggatcgtggaccagttcggggaggacaccctggaggtgctggaaaaattcccggaa
cggctccgggaggtcagcggcatcggcaagaaaaaggcggaagccatcatcacctcctac
ggggaactccgggaaaaccgggagctggtgtttttcctggaaagccacgggatcagcggg
aattttgccccccggatccaggccctctacggcagcacggcggtgacccggatcagcaac
aatccctactgcctggcggaagatgtggaaggcatcgggttccggacggcggacgccctg
gcccggaacctggggatggatgagcacggggacgaacggatccgggcggggatccactat
accctgctccagggggccggccaggggcatacctgcgtgccggattcctggctggtgggc
aatgcggccagggtgctccaggtggaccctctggaagtgcgccaggtgttcgaccagctg
ctccgggacaacctgctccgggcggaggaccggggggaccatgtgtgcgtgtacccggaa
tacctgtaccgggcggaagagggggtggcccaccggctgctggccctccgggacaatgtg
aacgccctgtggaaggtggattaccagaagatcatccgggaatgggaacgggatgaacgg
atccgactggcaccggaacaggcggaagcggtgaaggcttccgtggatcacggggtgttc
gtccttaccgggggcccgggtaccgggaaaaccaccgtggtgaaggggatcctgtcggtg
atggaacaggccggctgcaagatcctgctggcggctcccacgggacgggcggccaagcgg
ctgtcggaaagcgccgggaagccggccctcaccgtgcaccggctgctggaatacactccc
aacggggagggggattccttctggggacggaatgaggacaatcccctggaagccgatgcg
gtgatcgtggacgaagcctccatgatggacatcgtgctcatgtacaacctgctgaaggcc
ctgcccctgggctgccggctgatcctggtgggggacgtggaccagctgcccagcgtgggc
cccggctccgtgctccaggacataatccgcagcggcaccatgcccattgtccgtctggaa
aacgtgttccggcaggcggagctgagccccattgtccggaatgcccaccggatcaaccag
ggactgatgccccagtgggaaggggaaaaggatttccgtttccgggaattcgccacggaa
gaggagaccatgcactacattgtggatctctacgtccatctggccgcccggcagccccag
gacgccatccaggtgctgacccccatgcacaagaacctgtgcggggtggagaacctgaac
aacatgctccaggcccggatgaaccccccgtccccggagaaacaggagtaccggggcagt
ttcctgctgctccgggaaggggacaaggtgatgcagatccggaacaattacgacaagaac
gtgttcaacggggacatcggacggatctgcagcatccagggggcccatgtgaccgtggat
ttcccggatcgggcggaaggggaagcggtgacctatgagggagcggaagtctctgatctg
cggctggcctacgccatgagcgtccacaaaagccagggcagcgaatatgcggtggtgctg
atgcccctggtactgagccactacatcctgctccagcggaacctgttctacaccgccatc
acccgggccaagaagcaggtgtacctggccggcagccggcgggccctgcgcaccgccgtg
gaaaacgaccggacccggaagcgctacagcctcctggcagagcggctgaagcggtatggg
gagtga

DBGET integrated database retrieval system