KEGG   Acidaminococcus fermentans: Acfer_1529Help
Entry
Acfer_1529        CDS       T01151                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
afn  Acidaminococcus fermentans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:afn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1690406..1691020)
Genome map
AA seq 204 aa AA seqDB search
MIGFITGRVDHIGTNFCLVDTQGVGYRIFLNTGDLSRIQVDQKVKIYTYLSVREDALQLF
GFLSYDAYSLFTQLITVSGIGPKVAQGILSAAKVDAFYLAVKSRDLKFLTKLPGIGKKTA
ERLLLELKDMTGPEGLEEEGTAGGFDGDVPEDDTTTLGAVAEGLSYLGYTQGEIAQVLKK
LKVTADSRAEDLLKEALRLLARRS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggattcattaccggacgggtggaccatattggaacgaatttctgtctggtggac
acccagggggtgggctaccggattttcctgaataccggggatctgtcccggatccaggtg
gaccagaaggtgaagatctacacttatctgtccgtacgggaggatgccctccagctgttc
ggcttcctgtcctacgacgcctattccctgttcacccagctgatcaccgtcagcggcatc
ggtcccaaggtggcccagggcatcctgtcggcggccaaggtggatgccttctacctggcg
gtgaagagccgggacctgaaattcctcaccaagctgccgggcatcggcaagaagaccgct
gaacggctgctgctggaactgaaggacatgaccggtccggaaggcctggaagaagagggc
acggcagggggattcgacggagacgtgccggaggacgacaccaccaccctgggagcggtg
gccgaagggctcagttatctgggatacacccagggagaaatcgcccaggtgctgaaaaaa
ctgaaagtgactgctgacagcagggcggaggaccttctgaaggaggccctgcgccttttg
gccaggaggagttaa

DBGET integrated database retrieval system