KEGG   Acidaminococcus fermentans: Acfer_1533Help
Entry
Acfer_1533        CDS       T01151                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00260  Glycine, serine and threonine metabolism
afn00750  Vitamin B6 metabolism
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
afn01120  Microbial metabolism in diverse environments
afn01230  Biosynthesis of amino acids
Module
afn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acfer_1533
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acfer_1533
Enzymes [BR:afn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acfer_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Alba
Motif
Other DBs
NCBI-ProteinID: ADB47891
JGI: Acfer_1533
UniProt: D2RLD9
Position
complement(1694165..1695667)
Genome map
AA seq 500 aa AA seqDB search
MLYISTRGKTDMVSSAHAISNGLAADGGLFVPKEFPPISLAEIDAMREAPYSARALTVLA
RFLTDYSEDELKNCVETAYSKERFGDFPAPLHLLKDNLDVLELWHGPTCAFKDMALQILP
LFLTKAVQKTGEQKKLVILVATSGDTGKAAMAGFADVPETEVIVFYPQEGVSDIQKLQMV
TQRGANVHAVAVEGNFDDAQTGVKILFGSRPLAEELQAHGCAFSSANSINWGRLVPQIVY
YFSAYADAVNSGRIENGAPVNFAVPTGNFGDILAGFYAKLMGLPVNKFICASNSNNVLTD
FINTGVYNRKRPFHKTISPSMDILVSSNLERLLFEETDHNAVQVAEWMKELNEKGEYKIG
TELQNKILKDFFGTWVDEVETRETIGDVYNNYGYVMDPHTAVAYKAMEKYRLMTGDETYS
IVLSTASPFKFNDVVLASIDPDTYEGKALDPFVAMDDLSRLAKMPIPAGMQELSKLQKRQ
SDVVDKTRMEAEVKKLLGLE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgttatacattagtacaagagggaaaactgacatggtgagctcggctcacgccatttcc
aatggcctggcggcagacggtggactgttcgtccccaaggaatttccgcccatcagcctg
gctgaaatcgatgccatgcgggaagcaccctacagtgcccgggcactgacggtactggcc
cgttttctgacggattacagcgaagatgaactgaaaaactgtgtggaaacggcttacagc
aaggaacggttcggggatttcccggcaccgctgcaccttctgaaagacaacctggacgta
ctggaactgtggcatggccccacttgtgcgtttaaagacatggccctgcagattctgcct
ctgttcctgaccaaggcggtccagaagaccggggaacagaaaaaactggtgatcctggtg
gccacttccggggataccgggaaagcggccatggctgggttcgccgatgtgccggaaacg
gaggtcatcgtgttctatccccaggagggggtcagcgacatccagaaactccagatggtg
acccagcggggagccaatgtccatgccgtggccgtggaagggaacttcgacgatgcccag
accggggtgaagattctgttcggcagccggcctctggcggaagaactccaggcccacggc
tgtgccttctcttcggccaactccatcaactggggacggctggtgccccagatcgtgtac
tatttcagtgcctatgcggatgcggtgaacagtggccggatcgaaaacggggcccctgtg
aactttgccgtgcccaccgggaacttcggggacatcctggccgggttctatgccaaactg
atggggctgccggtgaacaagttcatctgtgcttccaacagcaacaatgtgctgacggac
ttcatcaataccggggtctacaaccggaagcgtccgttccacaagaccatttctccctcc
atggatatcctggtttccagcaacctggaacggctgttgttcgaagaaaccgaccataat
gcagtccaggtggcggaatggatgaaggaactgaacgaaaagggcgaatacaagatcggc
acggaactccagaacaagattttgaaggatttcttcggcacctgggtggacgaagtggaa
acccgggaaaccatcggggatgtgtacaacaactatggctatgtgatggatccccatacg
gcggtggcctacaaggccatggaaaagtaccggctgatgaccggggacgaaacctacagc
atcgtgctgagtaccgccagccccttcaagttcaatgatgtggtcctggcctccatcgat
ccggacacctacgaaggaaaggcactggatcctttcgtggccatggacgatttgagccgg
ctggccaagatgcccatcccggccgggatgcaggaactgtccaagctccagaaacgccag
agcgatgtggtggacaagacccggatggaagcggaagtgaagaagctgctgggtctggaa
taa

DBGET integrated database retrieval system