KEGG   Acidimicrobium ferrooxidans DSM 10331: Afer_0103Help
Entry
Afer_0103         CDS       T00956                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
afo  Acidimicrobium ferrooxidans DSM 10331
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:afo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111207..111824
Genome map
AA seq 205 aa AA seqDB search
MNSLPPTLDALIEELGRLPGIGPKSAQRIALALIVRGPAAAHRLADVLVTATERLGRCDR
CGALAEGARCPICDDPARDPRIVLVVEGDRDVWAFERARRFRGTYHVLGGVISPMDGVGP
DDLAIGRLIARVEAEPIEEVVVATSPTVEGETTATYLARVLAGRVGVSRLATGVPVGGEL
EYVDELTLARALEGRRPFDDAGPRR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaactcactgcctccaacgctggacgcgctcatcgaggagctcggtcgattgcctggc
atcggtccgaagtcggcgcaacgcatcgcgctggcgctcatcgtgcgcggcccggccgct
gcgcaccggctcgcagacgtcctcgtcaccgcgaccgagcggctcggtcgttgtgaccgc
tgcggggcgctcgcagagggggcgcgctgcccgatctgcgacgatccggcccgagatccg
cgcatcgtcctcgtcgtcgagggcgatcgcgacgtgtgggccttcgagcgggcgcgacgt
ttccgagggacctaccacgtcctcggcggcgtgatcagccccatggacggcgtcggacct
gatgatctcgccatcggccggctcatcgctcgcgtcgaggccgagccgatcgaggaggtc
gtggtcgcgacctcgccgaccgtggagggcgagacgacggcgacctacctcgccagagtg
ctggccgggcgcgtcggtgtctcgcgtcttgcgaccggcgtgcccgtcggcggcgagctg
gagtacgtcgacgagctgaccttggcgcgcgcgctcgagggccgacggcccttcgacgac
gcggggccgcgccgctag

DBGET integrated database retrieval system