KEGG   Acidimicrobium ferrooxidans: Afer_0103Help
Entry
Afer_0103         CDS       T00956                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:afo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Afer_0103
DNA repair and recombination proteins [BR:afo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Afer_0103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111207..111824
Genome map
AA seq 205 aa AA seqDB search
MNSLPPTLDALIEELGRLPGIGPKSAQRIALALIVRGPAAAHRLADVLVTATERLGRCDR
CGALAEGARCPICDDPARDPRIVLVVEGDRDVWAFERARRFRGTYHVLGGVISPMDGVGP
DDLAIGRLIARVEAEPIEEVVVATSPTVEGETTATYLARVLAGRVGVSRLATGVPVGGEL
EYVDELTLARALEGRRPFDDAGPRR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaactcactgcctccaacgctggacgcgctcatcgaggagctcggtcgattgcctggc
atcggtccgaagtcggcgcaacgcatcgcgctggcgctcatcgtgcgcggcccggccgct
gcgcaccggctcgcagacgtcctcgtcaccgcgaccgagcggctcggtcgttgtgaccgc
tgcggggcgctcgcagagggggcgcgctgcccgatctgcgacgatccggcccgagatccg
cgcatcgtcctcgtcgtcgagggcgatcgcgacgtgtgggccttcgagcgggcgcgacgt
ttccgagggacctaccacgtcctcggcggcgtgatcagccccatggacggcgtcggacct
gatgatctcgccatcggccggctcatcgctcgcgtcgaggccgagccgatcgaggaggtc
gtggtcgcgacctcgccgaccgtggagggcgagacgacggcgacctacctcgccagagtg
ctggccgggcgcgtcggtgtctcgcgtcttgcgaccggcgtgcccgtcggcggcgagctg
gagtacgtcgacgagctgaccttggcgcgcgcgctcgagggccgacggcccttcgacgac
gcggggccgcgccgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system