KEGG   Acidimicrobium ferrooxidans: Afer_0187Help
Entry
Afer_0187         CDS       T00956                                 

Definition
succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Afer_0187
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Afer_0187
   00650 Butanoate metabolism
    Afer_0187
  Energy metabolism
   00190 Oxidative phosphorylation
    Afer_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(193553..193930)
Genome map
AA seq 125 aa AA seqDB search
MAVFATPRSARRPRQNFETWAWLFMRVSGIVLFFLALIHMYIMHIENDVTQTTVAFVAHR
WSNPLWRLFDWLLLALGLLHGGNGLRTIVNDYVHRPVTKVITKSLLYGVSGVLFLLGTIT
VLTFH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcttcgccactcctcggagcgcacgacgacctcgccagaacttcgagacctgg
gcatggctcttcatgcgggtgtccgggatcgtcctgttcttcctggccctcatccacatg
tacatcatgcacatcgagaacgacgtgacccagaccaccgtggcgttcgtcgcccaccgc
tggtcgaatccgctctggcgcctgttcgactggctcctcctcgcccttggtctgctccac
ggcggtaacggccttcggaccatcgtgaacgactacgtgcaccgccccgtgaccaaggtc
atcaccaagtcgctgctctacggtgtcagcggcgtgctgttcctgctcggcaccatcacc
gtcttgacgttccactga

DBGET integrated database retrieval system