KEGG   Acidimicrobium ferrooxidans: Afer_0187Help
Entry
Afer_0187         CDS       T00956                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
afo  Acidimicrobium ferrooxidans
Pathway
afo00020  Citrate cycle (TCA cycle)
afo00190  Oxidative phosphorylation
afo00650  Butanoate metabolism
afo01100  Metabolic pathways
afo01110  Biosynthesis of secondary metabolites
afo01120  Microbial metabolism in diverse environments
afo01130  Biosynthesis of antibiotics
afo01200  Carbon metabolism
Module
afo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
afo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Afer_0187
   00650 Butanoate metabolism
    Afer_0187
  Energy metabolism
   00190 Oxidative phosphorylation
    Afer_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF2768
Motif
Other DBs
NCBI-ProteinID: ACU53156
UniProt: C7M258
Position
complement(193553..193930)
Genome map
AA seq 125 aa AA seqDB search
MAVFATPRSARRPRQNFETWAWLFMRVSGIVLFFLALIHMYIMHIENDVTQTTVAFVAHR
WSNPLWRLFDWLLLALGLLHGGNGLRTIVNDYVHRPVTKVITKSLLYGVSGVLFLLGTIT
VLTFH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcttcgccactcctcggagcgcacgacgacctcgccagaacttcgagacctgg
gcatggctcttcatgcgggtgtccgggatcgtcctgttcttcctggccctcatccacatg
tacatcatgcacatcgagaacgacgtgacccagaccaccgtggcgttcgtcgcccaccgc
tggtcgaatccgctctggcgcctgttcgactggctcctcctcgcccttggtctgctccac
ggcggtaacggccttcggaccatcgtgaacgactacgtgcaccgccccgtgaccaaggtc
atcaccaagtcgctgctctacggtgtcagcggcgtgctgttcctgctcggcaccatcacc
gtcttgacgttccactga

DBGET integrated database retrieval system