KEGG   Acidimicrobium ferrooxidans DSM 10331: Afer_0251Help
Entry
Afer_0251         CDS       T00956                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
afo  Acidimicrobium ferrooxidans DSM 10331
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:afo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255890..257362
Genome map
AA seq 490 aa AA seqDB search
MGRVALVGAGPGDPELLTLRGLRLVRAADVVVTDALVDRRVLAEVRPAVAVHDVGKRAGA
PFSQAAINELLIDLARGHELVVRLKGGDPFLFGRGGEELEALLAAGVAVEVVPGVPSATA
AADLVGVPLTHRGVADGFCVITGHRHGDASLDYDWRALVASGLTLVVLMGAASRATIAKE
LMGAGAPGETPVAVVTRASWIDEEVRWTSLAALGSVPVASPSTIIIGGVVDPRRRWRPSL
PLGGLRIVVTRPRAVADALAVRLRDLGAVVVASPAIEIGPPSDGGAALAAALSHIEDYDW
LVLTSQNAVDRVVGGIGDLRRLGGVRIAAIGPATARALERVHLTADLIPGTWVGEGLVEV
FGPGPGSVLIARARQARDVVPRGLEAKGWRVDVVEAYETRTAAASVPPELVESADLVVFT
APSTVEGFATQYPGLVPRAAAAIGPVTEEALVRRGWPVALTATHYDADGLVEVIREAREA
GRLVPRSEAP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggacgcgttgcgctcgtcggtgccggccctggcgacccagagctcctcacgctccgc
ggtctgaggctcgtgcgtgcggccgacgtcgtcgtcaccgacgctctcgttgatcgacgt
gtgcttgccgaggtgcggccggcggtcgcggtgcacgacgtcggcaagcgtgctggagca
cccttctcgcaggctgccatcaacgaactcctgatcgacctcgcccgcggccatgagctc
gtcgtgcggctgaagggcggcgacccgttcttgttcggtcgcggcggagaggagctcgag
gcgctgctggcagcgggggtcgccgtcgaggtggtccctggcgtgccgagtgcgacggcc
gcggcggacctcgtcggtgtcccgctcacccatcggggcgtggcggacggcttctgtgtg
atcaccggtcatcgccacggcgacgcgtcgctcgactacgactggcgtgcactcgtcgcg
agtgggctcacgctcgtcgtgctcatgggggccgcttctcgtgcgaccatcgccaaggag
ctgatgggcgccggagctcctggtgagaccccggtcgcggtcgtgacacgcgcatcgtgg
atcgatgaagaggtccgctggacgagcctcgcggcgctcgggtcggtgcctgtcgcgtct
ccgagcacgatcatcatcggcggcgtggtcgatccgcggcgccgatggcgaccctcgctg
ccgctcggtggcctccgtatcgtggtgacacgcccgagagcggtcgcagatgcgctcgcg
gtgcgcctccgcgatctcggtgccgtcgtcgtggcgagcccggcgatcgagatcggtccg
ccgtcggatggcggtgccgcactggccgcggcgctctcgcacatcgaggactacgactgg
ctcgtcctcacctcgcagaacgccgtcgatcgcgtcgtaggaggcatcggcgaccttcgg
cgtctcggtggcgtgcgcatcgcggccattggccccgcgaccgctcgggcgctcgagcgg
gtccacctcacggccgatctcatccccgggacgtgggttggggaggggctggtcgaggtg
ttcggccctggtcctggctcggtgctcatcgccagggcacgccaggcccgcgacgtcgtg
ccacggggcctcgaggcgaaggggtggcgcgtcgacgtcgtcgaggcgtacgagacgcgc
acagcagcggcgagcgtgcctccagagctcgtcgagagcgccgatctcgtcgtgttcacg
gcaccgtccaccgtcgagggtttcgcgacccagtacccggggctcgtccctcgggccgcg
gcggcgatcgggcccgtcaccgaggaggcgctggtgcggcgagggtggccggtcgcgctg
accgcgacgcactacgacgccgatggcctcgtggaggtgattcgcgaggcgcgcgaagcg
ggtcggctcgtgcctcgatccgaggcgccctag

DBGET integrated database retrieval system