KEGG   Acidimicrobium ferrooxidans: Afer_0252Help
Entry
Afer_0252         CDS       T00956                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Afer_0252
Enzymes [BR:afo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Afer_0252
Exosome [BR:afo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Afer_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
257373..258350
Genome map
AA seq 325 aa AA seqDB search
MASFPRPRRLRATPALRDLVAETVVRPQQLVLPLFVKEGISTPVPIASMPGVVQHTVDSL
VREVDEALAVGVRTVILFGVTDERDEDGSLACRADFVLERAIAALVARFATDVTVVADLC
LDEYTTHGHCGVLDAAGRVDNDATLVRYQALAVALASAGVHFVGPSGMMDHQVAAIREAL
DAHGFDDVGILAYAAKYASALYGPFRDAVEVEIAGGGDRASYQQDPRNRREAWREVDLDV
AEGADLVMVKPASFYLDVLSDVAERSPVPVLAYQVSGEYSMIVAASANGWLDRRLAVLES
LVAIRRAGADGILTYFAKEAAPWLR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgttcccaaggcccaggcgcctgcgtgccacgccggcgcttcgtgacctcgtt
gctgagaccgtcgtcagaccccaacagctcgtgctcccgctgttcgtgaaggaagggatc
tcgacccccgtgcccatcgcgtcgatgcctggggtcgtccagcacacggtggactcgctc
gttcgagaggtcgacgaggcgctcgccgtcggcgtacgaacggtgatcctcttcggcgtc
accgacgagcgggacgaggacggctcgctcgcgtgccgcgcggacttcgtgctcgagcgc
gcaatcgcggcgctcgttgcgcgcttcgcaacggacgtgacagtggtggccgacctctgc
ctcgacgagtacaccacgcacgggcactgtggggtgctcgatgctgccggacgcgtcgac
aacgacgccaccctcgttcgctaccaggcgctcgccgtggcccttgcgagcgcgggcgtc
cacttcgtcggcccctccggcatgatggatcaccaggtcgccgccatccgtgaggccctc
gacgctcatggattcgacgacgtcggcatcctcgcctatgccgcgaagtacgcatcggct
ctctacggccccttccgcgacgcggtcgaggtcgagatcgcaggcggcggcgaccgcgcg
agctaccagcaagatccccgcaaccgtcgcgaggcgtggcgagaggtcgacctcgacgtc
gccgagggcgcggacctggtgatggtcaagccggcgagcttctacctggacgtgctgtcg
gacgtcgccgaacgctcaccggtgccggtccttgcctaccaggtttcgggtgagtactcg
atgatcgtcgcggcgagcgcgaacggttggctcgatcgccgtctggcggtgctcgagtcg
ctggtcgccatccgacgagccggagcggacggcatcctcacctactttgccaaggaggca
gcgccgtggctgcgatga

DBGET integrated database retrieval system