KEGG   Acidimicrobium ferrooxidans DSM 10331: Afer_0273Help
Entry
Afer_0273         CDS       T00956                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
afo  Acidimicrobium ferrooxidans DSM 10331
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:afo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(281358..282311)
Genome map
AA seq 317 aa AA seqDB search
MTDEIIGPPDALVAPRFGGPATFARLPRLDEAPHARLVVLGVPFDAGTSYRPGARFGPSA
IRAGSKLLRPYNPDLDVWPFAEVQVADAGDVAANPFSIDAALTAITSAARELGEAGRTIV
TLGGDHTIALGLLRALAPRTGPLALVHFDAHLDTWDTYFDAPYTHGTPFRRAFEEGLLAP
DASVHVGTRGPLYARSDLTEDADMGFRVLAARDVDRIGVDGVVERIRDRVGTAPVYVSID
IDVLDPAFAPGTGTPEAGGLTSRELLAILDGLRDLSIRGADVVEVAPAYDHAEVTTIAAS
HVAYHLISIMAPEIARR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgagatcatcggaccgccagacgcgctcgtcgcgccgcgcttcggcggcccc
gcaaccttcgcacgcctgccccgtctcgacgaggcgcctcacgctcgcctggtcgtcctc
ggcgtccccttcgacgcgggtacgtcgtatcgaccaggagcacgctttggcccctcagcc
attcgagcgggctccaagctgctgcgcccatacaaccccgacctcgacgtctggccattc
gccgaagtacaggtcgccgacgcgggcgacgtggcggcgaacccgttctcgatcgacgct
gcgctcactgccatcacgagtgctgcgcgagagctcggcgaggctggtcgaaccatcgtc
accctcggaggcgatcacaccatcgcactggggctgttacgcgccctggcgccccgcact
ggaccactcgccctcgtccacttcgacgctcacctcgacacctgggacacctacttcgac
gcgccctacacgcacgggacgccgtttcgccgcgcgttcgaagaaggcctcctcgccccc
gacgcgagcgtgcacgtcggcacccgaggaccgctgtatgcgcgctccgacctcaccgag
gacgctgacatgggctttcgcgtcctcgccgcacgtgacgtcgatcgcatcggcgtcgat
ggcgtggtggagcgcatccgcgatcgtgtcggcaccgcacctgtctacgtctcgatcgac
atcgacgtgctcgacccggcttttgcgcccggaaccggcacaccagaggcgggagggctc
acctccagggaattgctcgcgatcctcgatgggctacgcgatctttccatccgtggcgcc
gacgtcgtcgaggtcgcacctgcctacgaccacgctgaggtcacgaccatcgcggcctcc
cacgttgcctaccacctcatctcgattatggcccctgagatcgcgcgccgctag

DBGET integrated database retrieval system