KEGG   Acidimicrobium ferrooxidans: Afer_0311Help
Entry
Afer_0311         CDS       T00956                                 

Definition
magnesium chelatase, ChlI subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Afer_0311
Enzymes [BR:afo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Afer_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(324751..326133)
Genome map
AA seq 460 aa AA seqDB search
MTQASGDHPTTLGDLARIGWHPRPVREEIRANVLERIRAGRPVVEGMVGYDDTVLPELTR
ALVSGHDVILLGERGQGKTRILRSLVALLDPFVPAVEGSALNEDPLAPVLASTKARLAAQ
GDATPIRWIARDERYSEKLATPDTTIADLIGEVDPIKVAAGRTLEDPEALTFGLVPRANR
GLFAINELPDLPERIQVGLLNALEERDVQVRGFTIRLPLDIVFLASANPEDYTARGRLIT
PLKDRFGTQLRTHYPSTIAEEVAIMRQEAQLCDPTVEIPEVLDELVAHTAHLARRHPAVS
RYSGVSVRGSIAAREAIAAAALVRAVRLGEHPPRARLGDTEATIAAFAGKIEVDAHDTSE
REIVATLLAQATARVFTERLGHLDPSDVIAETNDRPLAVDLDGPTATWEQILADRPALAA
MGDHAPPSERLVLAELCLEGLVATRRLGKRVLGNRVSYGS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaggcttcaggcgaccacccaaccacgctcggcgacctcgcgcgcatcggttgg
cacccgcgcccggttcgcgaagagattcgcgccaacgtcctcgagcgcatccgcgcaggc
cgccccgtcgtcgagggcatggtcggctacgacgacaccgtgctcccagaactgacgcgc
gccttggtgagcgggcatgacgtgattctccttggcgagcgcggccagggcaagacgcgg
atcctgcgttccctcgtcgcgctgctggaccccttcgtccccgccgtcgagggctcggcg
ctcaacgaggacccgctcgcgcccgtcctcgcctcgaccaaggcccgactcgccgcccaa
ggcgatgcgacgcccatccgctggatcgcccgcgacgagcgctacagcgagaaactcgcg
actcccgacacgaccatcgctgatctgatcggagaggtcgacccgatcaaggttgcggcg
ggtcgcacgctcgaggaccccgaagcactcacgttcggcctcgttccacgggcgaaccgc
ggcctcttcgccatcaacgaactccccgacctgcccgaacgaatccaggtcggtctgctg
aacgcgcttgaggagcgtgacgtccaggtccgcggcttcaccattcggctccccttggac
atcgtgttcctcgcgtcggccaacccggaggactacaccgcgcgtgggcgcctcatcaca
ccgctgaaggaccgcttcggcacgcagctacgaacgcactacccgtcgacgatcgcagaa
gaagtcgccatcatgcgacaagaggctcagctgtgcgacccaaccgtcgagataccggag
gtcctcgacgaactcgtcgcccacacggcccacctcgcacggcggcaccctgcggtctct
cgctactcaggcgtctccgttcgagggtcgatcgcagcccgagaggcgatcgctgccgcg
gcactcgttcgggccgttcgcctcggcgagcacccgcctcgcgcacgccttggcgatacc
gaggcgaccatcgcggccttcgcgggcaagatcgaggtcgatgcccacgacacctcggag
cgcgagatcgtggccaccttgctcgctcaagcgaccgctcgagtcttcaccgagcggctc
ggccatctcgacccgtcggacgtcatcgccgagaccaacgatcgcccgctcgccgtcgat
ctcgatggccccacggccacatgggagcagatcctcgccgatcgaccggcgctggctgcc
atgggcgaccacgccccgccgtcggagcgcctggtactcgccgaactgtgtctcgaggga
ctcgtggcgacacgcagactcggcaagcgcgtccttggcaaccgagtgagctacgggagc
tga

DBGET integrated database retrieval system