KEGG   Acidimicrobium ferrooxidans: Afer_0319Help
Entry
Afer_0319         CDS       T00956                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Afer_0319
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Afer_0319
   00640 Propanoate metabolism
    Afer_0319
   00660 C5-Branched dibasic acid metabolism
    Afer_0319
Enzymes [BR:afo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Afer_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
330876..332024
Genome map
AA seq 382 aa AA seqDB search
MDLKEYQGKDLFRRFGVPTSEGRVCVTVEEAVAAAETLGYPVVVKAQVLVGGRGKAGGVR
VAATEEALREAAGAILGMDLKGHRVKEVWIEPASDIRREYYASFTLDRTARQYLLMLSAM
GGVDIEEVARTHPEAIARVHIDPIDGLTPALAEQAVATAGIDEGREELPAMLGALYRAFV
EGDADLVEVNPLIVRSDGKLWALDAKVTLDDSAAFRHPEWEAYRADEELDSREAIARARG
LNYIGLEGSVGIIANGAGLAMSTLDVVQQVGGRAANFLDLGGGAGADTMTAALEVIATDP
QVRALLVNIFGGITRCDEVARGIVAALERVRLPFPMVVRLDGTNAAEGRAILSSVVSDSI
IVEPTMIKAAERAVAEASKAVA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgaaggagtaccaaggcaaggacctgttccgccgtttcggggtgccgacctcg
gagggacgggtctgcgtcacggtcgaggaggcggttgccgcggccgagacgctggggtat
ccggtcgtcgtgaaggcccaggtgttggtcggcgggcgcggcaaggctggtggcgtccgt
gtggccgccaccgaggaggcgctccgcgaggcagcgggtgccatcttgggcatggacctg
aagggccatcgggtgaaggaggtctggatcgagccggcttccgacattcgccgcgagtac
tacgccagcttcacgctcgatcggacggcgcgtcagtacctgctcatgctctcggcgatg
ggtggcgtggacatcgaggaggtggctcggacgcaccctgaggcgattgcgcgggtgcac
atcgatcccatcgacggtctgaccccggccctcgccgaacaggccgttgcgaccgcaggg
atcgacgagggtcgcgaggagctgccggcgatgttgggtgcgctctatcgcgccttcgtc
gaaggcgatgccgacctcgtcgaggtgaacccgttgatcgtccgatccgacggcaagctc
tgggcgctcgatgccaaggtgacgctcgacgacagtgccgcgttccgccatcccgagtgg
gaggcgtatcgggccgacgaggagctcgactcgcgcgaggcgatcgctcgtgctcggggc
ttgaactacatcggtctcgagggatccgtcggcatcatcgccaatggcgccggactcgcc
atgtccaccttggacgtggtccagcaggtcggtgggcgagcggcgaacttcctcgatctg
ggaggaggcgccggcgccgacacgatgacggcggcgctcgaggtgatcgcgacggatccg
caggtccgggcgctcctcgtgaacatcttcggcggcatcacccgctgcgacgaggttgct
cgaggcatcgtcgccgcgctcgagcgcgtgcgccttccgttccccatggtcgtccggctc
gacggcacgaacgccgccgagggcagggccattctctcgtcggttgtgtcggacagcatc
atcgtcgagccgacgatgatcaaggcggccgagcgcgccgtcgcggaagcttcgaaggcg
gtcgcatga

DBGET integrated database retrieval system