KEGG   Acidimicrobium ferrooxidans: Afer_0319Help
Entry
Afer_0319         CDS       T00956                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
afo00020  Citrate cycle (TCA cycle)
afo00640  Propanoate metabolism
afo00660  C5-Branched dibasic acid metabolism
afo01100  Metabolic pathways
afo01110  Biosynthesis of secondary metabolites
afo01120  Microbial metabolism in diverse environments
afo01130  Biosynthesis of antibiotics
afo01200  Carbon metabolism
Module
afo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Afer_0319
   00640 Propanoate metabolism
    Afer_0319
   00660 C5-Branched dibasic acid metabolism
    Afer_0319
Enzymes [BR:afo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Afer_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A Succ_CoA_lig ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACU53287
UniProt: C7M2P3
Position
330876..332024
Genome map
AA seq 382 aa AA seqDB search
MDLKEYQGKDLFRRFGVPTSEGRVCVTVEEAVAAAETLGYPVVVKAQVLVGGRGKAGGVR
VAATEEALREAAGAILGMDLKGHRVKEVWIEPASDIRREYYASFTLDRTARQYLLMLSAM
GGVDIEEVARTHPEAIARVHIDPIDGLTPALAEQAVATAGIDEGREELPAMLGALYRAFV
EGDADLVEVNPLIVRSDGKLWALDAKVTLDDSAAFRHPEWEAYRADEELDSREAIARARG
LNYIGLEGSVGIIANGAGLAMSTLDVVQQVGGRAANFLDLGGGAGADTMTAALEVIATDP
QVRALLVNIFGGITRCDEVARGIVAALERVRLPFPMVVRLDGTNAAEGRAILSSVVSDSI
IVEPTMIKAAERAVAEASKAVA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgaaggagtaccaaggcaaggacctgttccgccgtttcggggtgccgacctcg
gagggacgggtctgcgtcacggtcgaggaggcggttgccgcggccgagacgctggggtat
ccggtcgtcgtgaaggcccaggtgttggtcggcgggcgcggcaaggctggtggcgtccgt
gtggccgccaccgaggaggcgctccgcgaggcagcgggtgccatcttgggcatggacctg
aagggccatcgggtgaaggaggtctggatcgagccggcttccgacattcgccgcgagtac
tacgccagcttcacgctcgatcggacggcgcgtcagtacctgctcatgctctcggcgatg
ggtggcgtggacatcgaggaggtggctcggacgcaccctgaggcgattgcgcgggtgcac
atcgatcccatcgacggtctgaccccggccctcgccgaacaggccgttgcgaccgcaggg
atcgacgagggtcgcgaggagctgccggcgatgttgggtgcgctctatcgcgccttcgtc
gaaggcgatgccgacctcgtcgaggtgaacccgttgatcgtccgatccgacggcaagctc
tgggcgctcgatgccaaggtgacgctcgacgacagtgccgcgttccgccatcccgagtgg
gaggcgtatcgggccgacgaggagctcgactcgcgcgaggcgatcgctcgtgctcggggc
ttgaactacatcggtctcgagggatccgtcggcatcatcgccaatggcgccggactcgcc
atgtccaccttggacgtggtccagcaggtcggtgggcgagcggcgaacttcctcgatctg
ggaggaggcgccggcgccgacacgatgacggcggcgctcgaggtgatcgcgacggatccg
caggtccgggcgctcctcgtgaacatcttcggcggcatcacccgctgcgacgaggttgct
cgaggcatcgtcgccgcgctcgagcgcgtgcgccttccgttccccatggtcgtccggctc
gacggcacgaacgccgccgagggcagggccattctctcgtcggttgtgtcggacagcatc
atcgtcgagccgacgatgatcaaggcggccgagcgcgccgtcgcggaagcttcgaaggcg
gtcgcatga

DBGET integrated database retrieval system