KEGG   Acidimicrobium ferrooxidans: Afer_0497Help
Entry
Afer_0497         CDS       T00956                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Afer_0497
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Afer_0497
   00052 Galactose metabolism
    Afer_0497
   00500 Starch and sucrose metabolism
    Afer_0497
   00520 Amino sugar and nucleotide sugar metabolism
    Afer_0497
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Afer_0497
   00524 Butirosin and neomycin biosynthesis
    Afer_0497
Enzymes [BR:afo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Afer_0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
501336..502205
Genome map
AA seq 289 aa AA seqDB search
MSDEILAVDLGGTNFRMAKVSSEGVLLARAEIPTASITDVVDGLGRLVDQVDGGGVATLV
FAAPGVVDRDAGTVVFCGNLDDAVRRTIVASRIADALAKRVVLVNDADAAAIGEAWAGAG
RGARTVVYVTVSTGIGAGLVHRGTLYVGRFTGMEAGQIRLGLEDVDRAEHVGSGTALART
ARQLGLELANPEVVRRAHQEGVARLALTRTMEALGVTLANLAWLLVPDRIVIGGGLGLSD
PLVLELATQAFHRAGPAFLEDLSIVPAALGDDAGLIGAAFAERALQGAQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgagatcctcgcggtcgatctcggcgggacgaactttcgcatggccaaggtg
agcagcgagggcgtgctgctcgctcgggccgagatcccgacggcgtcgatcaccgacgtc
gtggacggcctcggtcggctcgtcgaccaggtcgacggtggcggggtcgcaacgctcgtg
ttcgcggcccctggcgtcgtcgaccgtgacgcgggcacggtcgtcttctgcgggaacctc
gatgacgccgtgcggcgcaccatcgtcgcgagccggatcgccgatgcgctcgccaagcgc
gtcgtcctcgtcaacgacgccgatgcggccgccatcggtgaggcgtgggcgggagccggg
cgcggcgctcgaacggtcgtgtacgtgaccgtctcgaccgggatcggtgcgggtctcgtc
caccgcggcacgctctacgtcgggcgcttcacgggcatggaggccggtcagatccgtctc
ggcctcgaagacgtcgatcgcgccgagcacgtcggttcggggaccgcgctcgctcgtacc
gcccgccagctcgggctcgagctcgccaaccccgaggtcgtgcgccgcgcgcaccaggag
ggtgtcgcgcgcctcgcgctcacccgcacgatggaggcgctcggggtcacgctcgccaac
ctcgcctggctcctcgtgcccgatcgcatcgtcatcgggggcgggctcggcctgtcggat
ccgctggtcctcgagctcgccacgcaggcgttccaccgcgccggcccggcgttcctcgag
gatctctccatcgtcccggccgcgctcggcgacgacgccggactcatcggggcggcgttc
gcggagcgggcgctccaaggcgcccagtga

DBGET integrated database retrieval system