KEGG   Acidimicrobium ferrooxidans: Afer_0661Help
Entry
Afer_0661         CDS       T00956                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Afer_0661
  Amino acid metabolism
   00300 Lysine biosynthesis
    Afer_0661
Enzymes [BR:afo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Afer_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
670601..671635
Genome map
AA seq 344 aa AA seqDB search
MRDPVELAAAYLEVPSVTGDEAALARLVGEHLDAAGLRVEVVAGCVVARNHGGDSSATLL
VGHLDTVPGELPVAVDELVLRGRGAVDMKAGLAVAVALACSEPSVPVTVVAYPGEEGPIT
GNGLAHLVAERPELLAGARGVLLEPTGGFLELGCQGVVRATLRLRGRRAHVARAWMGRNA
IDRVGEALGTLRALERREPQIGPVRYREAIEVVGVRGGVAWNVVPDLVEIDVSYRFAPDL
DAARARQRLEEAVRPVMDDGDDLEVAEAVPGAVSDLGRFGALRSGAFGVRAKLGWTDVAQ
LVAAGVPAVNFGPGDPELAHTDQEMVEVAEVRHVAQALWRWLHA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgagggacccggtcgagctcgcggcggcctacctcgaggttccctccgtcaccggcgac
gaggcggcgctcgctcggctcgtcggtgagcacctcgatgcggcggggcttcgagtcgag
gtggtggcgggctgcgtcgtggctcgcaaccacggcggggactcctcggcgacgctgctc
gtcggccatctcgacaccgttcccggtgagctccctgtcgccgtcgacgaactggtgttg
cgtggacggggtgccgtcgacatgaaggcagggctcgcggtcgcggtggcgctggcgtgc
tcggagccctccgtgcccgtgaccgtcgtcgcctatccgggcgaggagggtccgatcaca
ggcaacgggctcgcgcacctcgtggccgagcgccccgaactcctcgcgggtgctcgcggc
gtgctcctcgaacccacgggtgggttcctcgagctggggtgccaaggggtcgtgcgcgcg
acgctccgactgcgtgggcgtcgagcccacgttgctcgagcctggatgggccgcaacgcc
atcgatcgggtcggcgaggcgctcgggacgcttcgcgccctggaacgtcgcgaaccccag
atcggcccggtgcgctaccgcgaggcgatcgaggtcgtcggggtgcgtgggggcgttgca
tggaacgtcgtgccggacctcgtcgagatcgacgtgagctatcggttcgcccccgacctc
gatgctgcccgggcgcgccagcgcctcgaggaggccgtgcgtcccgtgatggacgacggt
gatgacctcgaggtcgccgaggccgtgccgggcgcggtgagtgacctcggtcggttcggc
gcactgcgcagcggcgcgttcggcgtgcgtgccaagctcggctggaccgacgtcgcccaa
ctcgtcgcggcgggcgtgccggcggtgaacttcggaccgggggatccagaacttgcccac
acggatcaggagatggtcgaggtggccgaggtgcgccacgtcgcccaggcgctgtggcgg
tggttgcacgcctag

DBGET integrated database retrieval system