KEGG   Acidimicrobium ferrooxidans: Afer_0718Help
Entry
Afer_0718         CDS       T00956                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Afer_0718
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Afer_0718
  Amino acid metabolism
   00310 Lysine degradation
    Afer_0718
Enzymes [BR:afo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Afer_0718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
723495..725117
Genome map
AA seq 540 aa AA seqDB search
MADVTLPQLGETVTEGTITKWLIKVGDTVEIDQPIFEVSTDKVDSEVPSPVSGVVTEILV
PDGETVDVGTVLCRIEAAASAASASSGPSTPPAAQAAPAPQPASAPQPASAPQPAPAPQP
ASAPQPAPAPQAAPVPQPAPAPQPAPVAMATSTSSQPAPSTPPAPSAPVSPSPSTVEANG
VAAGSGPERDLDGLLLSPVVRRLIIDNGLDPRDLHGTGVGGRITRGDVLRALDERARSAA
GSAPPATSEPAPSVANEPAPSVAREAAPQPTAASAPELWSPSQEPTPSNRAQQVVPVSAM
EPSERDYVVPFTNIRRRTAEHMIRSKATSAHTLMSIEVDFEGVEQVRRRVRESFARDEGF
SLTYLPFVVRASVEAIRAYPNINASVLGDALVVHRDINIAIAVDLNLEGLIAPVIHGADA
IRLRGIARAIHDLAARARSRKLSADDIANGTFTITNPGPFGTFMTGAIINQPQVAILATD
GITRRPVVVTDAHGAESIAIHSVGLLTVNFDHRAIDGAYAAAFLAKAKQVIEQTAWEQEL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
ttggctgatgtcacgcttcctcaacttggcgaaaccgtcaccgaggggacgatcacgaag
tggctgatcaaggtgggtgacaccgtcgagatcgaccagccgatcttcgaggtctcgacc
gacaaggtggattccgaggtcccttcgcccgtctccggggtcgtcaccgagatcctcgtc
cccgacggtgagaccgtggacgtggggacggtcctgtgccgcatcgaagccgcggcgtcg
gctgcgtcggcatcatcggggccctcgacgcctccagccgcacaggccgctccggcgcca
cagcccgcgtcggcgccacagcccgcgtcggcgccccagcccgctccggcgccacagccc
gcgtcggcgccccagcccgctccggcgccacaggctgcaccagtgccccagcccgcacca
gcgccccagcccgcgccggtcgcgatggcaacgagcaccagttcgcagccagccccgagc
acgcctcctgctccatcagcgcccgtgtcgccgtcgccgagcacggtcgaggccaacggc
gtcgccgccggcagcggtcccgaacgagacctcgatggcctcctgctctcgccggtcgtt
cgtcgtctcatcatcgacaacggcctcgacccgcgagacctccacgggaccggcgtcggc
ggacggatcacacgaggcgacgtcctgcgcgccctcgacgagcgggcccggtcggctgcg
ggatcggctccaccggccacgagcgagccggccccctcggtcgccaacgagccggccccc
tcggtcgcccgtgaggcagcgccgcagccgacggccgcgtcggcgcctgagctctggtcg
ccgagccaggaaccgacaccgagcaaccgtgcccagcaggtcgtccccgtgtcggccatg
gagccgagcgaacgtgattacgtcgtgccgttcacgaacattcgacgccgtaccgccgag
cacatgatccgctccaaggccacctccgctcatacgctcatgtcgatcgaggtcgacttc
gagggtgtcgagcaggtccggcgacgtgtgcgtgagtcgttcgctcgcgacgagggtttt
tcgctcacgtacctgccgttcgtggtgcgagcctccgtcgaggcgattcgcgcctacccc
aacatcaacgcctcggtgctcggtgacgccctcgttgtgcatcgggacatcaacatcgcg
atcgcggtggatctcaacctcgaggggttgatcgccccagtgatccatggggccgacgcc
atcagattgcgcggtatcgctcgcgcgatccacgacctcgctgcccgagcgcgcagccgc
aagctgagcgccgacgacatcgccaatggcacgttcacgatcacgaacccgggtccgttc
gggaccttcatgaccggggcgatcatcaaccagcctcaggttgcgatcctcgcgaccgac
gggatcacccgtcggcccgtggtggtcacggatgcccatggagcggagtccattgcgatc
cactcggtggggctgctcacggtcaacttcgaccatcgggcgatcgacggcgcctatgcg
gcggcgttccttgcgaaggcaaagcaggtgatcgagcagacggcgtgggagcaggagctg
tga

DBGET integrated database retrieval system