KEGG   Acidimicrobium ferrooxidans: Afer_0718Help
Entry
Afer_0718         CDS       T00956                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
afo00020  Citrate cycle (TCA cycle)
afo00310  Lysine degradation
afo01100  Metabolic pathways
afo01110  Biosynthesis of secondary metabolites
afo01120  Microbial metabolism in diverse environments
afo01130  Biosynthesis of antibiotics
afo01200  Carbon metabolism
Module
afo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Afer_0718
  Amino acid metabolism
   00310 Lysine degradation
    Afer_0718
Enzymes [BR:afo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Afer_0718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 HlyD_D23 GCV_H QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ACU53668
UniProt: C7LY60
Position
723495..725117
Genome map
AA seq 540 aa AA seqDB search
MADVTLPQLGETVTEGTITKWLIKVGDTVEIDQPIFEVSTDKVDSEVPSPVSGVVTEILV
PDGETVDVGTVLCRIEAAASAASASSGPSTPPAAQAAPAPQPASAPQPASAPQPAPAPQP
ASAPQPAPAPQAAPVPQPAPAPQPAPVAMATSTSSQPAPSTPPAPSAPVSPSPSTVEANG
VAAGSGPERDLDGLLLSPVVRRLIIDNGLDPRDLHGTGVGGRITRGDVLRALDERARSAA
GSAPPATSEPAPSVANEPAPSVAREAAPQPTAASAPELWSPSQEPTPSNRAQQVVPVSAM
EPSERDYVVPFTNIRRRTAEHMIRSKATSAHTLMSIEVDFEGVEQVRRRVRESFARDEGF
SLTYLPFVVRASVEAIRAYPNINASVLGDALVVHRDINIAIAVDLNLEGLIAPVIHGADA
IRLRGIARAIHDLAARARSRKLSADDIANGTFTITNPGPFGTFMTGAIINQPQVAILATD
GITRRPVVVTDAHGAESIAIHSVGLLTVNFDHRAIDGAYAAAFLAKAKQVIEQTAWEQEL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
ttggctgatgtcacgcttcctcaacttggcgaaaccgtcaccgaggggacgatcacgaag
tggctgatcaaggtgggtgacaccgtcgagatcgaccagccgatcttcgaggtctcgacc
gacaaggtggattccgaggtcccttcgcccgtctccggggtcgtcaccgagatcctcgtc
cccgacggtgagaccgtggacgtggggacggtcctgtgccgcatcgaagccgcggcgtcg
gctgcgtcggcatcatcggggccctcgacgcctccagccgcacaggccgctccggcgcca
cagcccgcgtcggcgccacagcccgcgtcggcgccccagcccgctccggcgccacagccc
gcgtcggcgccccagcccgctccggcgccacaggctgcaccagtgccccagcccgcacca
gcgccccagcccgcgccggtcgcgatggcaacgagcaccagttcgcagccagccccgagc
acgcctcctgctccatcagcgcccgtgtcgccgtcgccgagcacggtcgaggccaacggc
gtcgccgccggcagcggtcccgaacgagacctcgatggcctcctgctctcgccggtcgtt
cgtcgtctcatcatcgacaacggcctcgacccgcgagacctccacgggaccggcgtcggc
ggacggatcacacgaggcgacgtcctgcgcgccctcgacgagcgggcccggtcggctgcg
ggatcggctccaccggccacgagcgagccggccccctcggtcgccaacgagccggccccc
tcggtcgcccgtgaggcagcgccgcagccgacggccgcgtcggcgcctgagctctggtcg
ccgagccaggaaccgacaccgagcaaccgtgcccagcaggtcgtccccgtgtcggccatg
gagccgagcgaacgtgattacgtcgtgccgttcacgaacattcgacgccgtaccgccgag
cacatgatccgctccaaggccacctccgctcatacgctcatgtcgatcgaggtcgacttc
gagggtgtcgagcaggtccggcgacgtgtgcgtgagtcgttcgctcgcgacgagggtttt
tcgctcacgtacctgccgttcgtggtgcgagcctccgtcgaggcgattcgcgcctacccc
aacatcaacgcctcggtgctcggtgacgccctcgttgtgcatcgggacatcaacatcgcg
atcgcggtggatctcaacctcgaggggttgatcgccccagtgatccatggggccgacgcc
atcagattgcgcggtatcgctcgcgcgatccacgacctcgctgcccgagcgcgcagccgc
aagctgagcgccgacgacatcgccaatggcacgttcacgatcacgaacccgggtccgttc
gggaccttcatgaccggggcgatcatcaaccagcctcaggttgcgatcctcgcgaccgac
gggatcacccgtcggcccgtggtggtcacggatgcccatggagcggagtccattgcgatc
cactcggtggggctgctcacggtcaacttcgaccatcgggcgatcgacggcgcctatgcg
gcggcgttccttgcgaaggcaaagcaggtgatcgagcagacggcgtgggagcaggagctg
tga

DBGET integrated database retrieval system