KEGG   Acidimicrobium ferrooxidans: Afer_0740Help
Entry
Afer_0740         CDS       T00956                                 

Definition
(GenBank) F420-dependent oxidoreductase
  KO
K12234  coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
afo00680  Methane metabolism
afo01120  Microbial metabolism in diverse environments
Module
afo_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Afer_0740
Enzymes [BR:afo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Afer_0740
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Afer_0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_ligase
Motif
Other DBs
NCBI-ProteinID: ACU53690
UniProt: C7LY82
Position
complement(749682..750380)
Genome map
AA seq 232 aa AA seqDB search
MRRLTIWSIPIDREICAGDNLGDLLGATGELADGDVVCVSQKAVSKAEGRVIQSDPEHLD
EAFEAALAAETRRVLRVRGTTRIVETHHGFVCANAGIDRSNAPAHALVLLPEDPDRSARR
IRDRLRFAWNLHVGVIVTDTFGRAWREGVTDVAIGVAGVRAILDLRGTADWTGATLRVTE
VCIADEIAAAANLVATKAAGTPFSVVRGIDPAWLAESSARAIVRDSARDLFR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagacggctcacgatctggtcgatccccatcgatcgcgagatctgcgccggggacaac
cttggcgatctcctgggcgcgaccggcgagctcgcagacggcgacgtcgtctgcgtgtcg
caaaaggccgtctccaaggccgaaggtcgcgtgatccagagcgaccccgagcatctcgac
gaggcgttcgaggccgcactcgctgccgagacgcgcagggtgctgcgcgtgcgtggcacc
acgcgcatcgtggagacccaccacggcttcgtctgcgcgaacgccggtatcgaccgttcg
aacgcccccgcacatgcgctcgtgctgctcccggaggatccggatcgctcggcgcgtcgg
attcgcgatcgcctgcgctttgcatggaacctccacgtcggtgtcatcgtcaccgacacc
ttcggtcgagcgtggcgcgagggggtcaccgacgtcgccatcggggtggcgggggttcgg
gcaatcctcgacctgcgtggcaccgccgactggaccggcgcaaccttgcgcgtgaccgag
gtctgcatcgccgacgagatcgcagcggcggcgaatctcgtcgcgacgaaggctgccggc
acgcccttcagcgtcgtgcgaggcatcgaccccgcctggctcgccgagtcgtccgcccgc
gccatcgtgcgcgacagcgctcgagacctctttcgctga

DBGET integrated database retrieval system