KEGG   Acidimicrobium ferrooxidans: Afer_0817Help
Entry
Afer_0817         CDS       T00956                                 

Definition
Magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Afer_0817
Enzymes [BR:afo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Afer_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833289..835112
Genome map
AA seq 607 aa AA seqDB search
MIRIDSVEGNDEAKLAIALLAVDPTIGGVLFVGPPGVAKSTLARSLADLGEDAPFVEVPL
GATEDRVKGSIDVTSALRDGDVVLRRGLLGAADGGVLYLDEVNLQPDHIVDLLLDAAATG
VNRVERDGLSATEPARFALVATMNPEEGALRPQLRDRFAMLVEVGPPPTREARLRALRRA
LRGENPSVDADRSTVVAARERLSQVDIGDAIEAAVDAAIAADVASLRADVAMVRAARAHA
ALSGKTAAGADDVRAVAPLIVRGRTGSAPRVSSATGASRAPSTTPPPPAVRSPGDARGEL
GGGAADRGGSASSVTSSSARRGPDDREGVSSEGVSSEGVASTSAGGEAGDAAGTDTDGEA
VAGERWAAGQRHPLVGGALSRVRAHSGALGREAHELGASNDAGAISVARSVLARLERQGG
GPLGPEDLRRTERARREARCVVLLVDASGSQAAEVALEIASQVAEELLLHAYQARAHVAA
VAFGGDGATVVLRPTRSIEVARARLGAIERRGATPLAAGFDVTAELVVQLRHRGMEPLVV
VVTDGRPTVGGRGLGPIEAALSAARELGRLGVDGVMVEVGRASRDGLELAARLAAEAGLG
HVVAADA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcatcgacagcgtcgagggcaacgacgaggccaagctcgccatcgcactgctc
gcggtcgatccgaccattggcggcgtcttgttcgtcggacctcctggcgtggcgaagtcg
acgctcgcgcgttcgctcgccgaccttggcgaggacgcccccttcgtcgaggtgccgctc
ggtgcgaccgaggacagggtcaagggttcgatcgacgtcacgagtgcgctgcgcgacggc
gacgtggtgctgcgccgaggtcttctcggcgctgccgacggtggcgtgctctatctcgac
gaggtgaacctccagcccgatcacatcgtggatctgctgctcgatgcggcggcgaccggc
gtcaatcgcgtcgagcgagacgggctgtcggccacggagccggcacgtttcgccctggtc
gccaccatgaaccccgaggagggggccttgcgtccccagctacgcgatcgcttcgccatg
ctggtcgaggtcgggccgccccccacgcgagaggcgcgcctgcgggcgcttcggcgagca
ctgcgcggcgagaacccgagtgtcgacgccgaccgcagcaccgtcgtcgccgcacgagaa
cgtctctcgcaggtcgacatcggcgacgccatcgaggcagcggtcgacgccgcgatcgct
gccgacgtagcctccttgcgtgcggacgtcgcgatggtgcgagcagcacgtgcgcacgct
gcgctctcggggaagacggccgctggagccgacgacgtgagggcggtcgcgcccctgatc
gtacgcgggcgaacagggagcgcaccacgcgtctcgtcggcgacgggagcctcccgcgct
ccgtccacgacgccacctccgccagcggtgcgttcgcccggggatgctcgcggtgagctc
ggcggtggggcagcggatcgcggcggctcggcgagctcggtgacgtcgtcctcggcgcgt
cgaggtcccgatgaccgcgagggggtctcgtccgagggggtctcgtccgagggggtcgcg
tcgacgagtgcgggtggcgaagccggcgacgctgccggcaccgataccgatggcgaggct
gtagctggggagcgatgggcggcgggccagcgccacccgctggtcgggggagcgctctcg
cgtgtgcgcgctcactcgggggcgttggggcgcgaggcccacgaactcggtgcctccaac
gacgccggtgccatttcggtggcgcggagcgtgctcgcgcgactcgagcgtcaaggggga
ggcccgctgggtccggaggacctgcgccgaaccgagcgagcacgccgcgaggcgcgctgt
gtcgtgctcctcgtcgacgcctcgggctcacaggctgccgaggtcgcgttggagatcgct
tcgcaggttgccgaggaactgctcctgcatgcctaccaggcgagggcacacgtcgcggcg
gtggccttcggcggcgacggtgccaccgtcgtgctgcggcccacgcggtcgatcgaggtc
gcccgggcgcgactcggtgcgatcgagcgccgcggtgcgacgccgctcgccgctggtttc
gacgtcacggccgagctcgtggtgcagctgcgccatcgaggcatggagccgctcgtggtc
gtggtgaccgatgggcgtccgacggtcggtgggcgcgggctcgggccgatcgaagcggcc
ctcagcgctgctcgcgagctgggtcgcctcggtgtcgacggagtgatggtggaggtgggt
cgcgcgtcgcgtgatggcctcgaactcgccgcgcgactcgcggccgaggccggtctcggt
cacgtcgtcgctgctgatgcgtga

DBGET integrated database retrieval system