KEGG   Acidimicrobium ferrooxidans: Afer_0825Help
Entry
Afer_0825         CDS       T00956                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Afer_0825
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Afer_0825
   00020 Citrate cycle (TCA cycle)
    Afer_0825
   00620 Pyruvate metabolism
    Afer_0825
Enzymes [BR:afo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Afer_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
845184..846467
Genome map
AA seq 427 aa AA seqDB search
MEWKFPDVGEGLHEAQVVAWHVHEGDAIERDAPLVDVETDKSVVTIPAPVAGTVEKILFH
EGDTVHVGEVVVVFGDGSAPAPSPLQPTASPAHVPAPPVAPAPTPASEPLARGVDRGIVL
ATPAVRRLARELGVDLASVVGSGERGRVLADDVRRFAASPESTESAVAAVSTLSTGAPRA
DRGAGDDGVAPLAVEADERRPLVGIRKRIAENMARSWSHAVQVTVVEEVVVDELVALRER
INAHLGEQRISYLPIFVKAAASLLARFPELNASLDEEASELVYHAHRNIGIAVDDPQGLM
VPVVRDADRRSIRELGLELERLIQGARAHTLGPRDLTGSTFTITNFGSIGGIVATPIINY
PDVAILGVGPIRRRAVVGPDDVIVPASVLFVSLTFDHRVVDGGTASRFLVALSELLRDPA
ALVAELV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggagtggaagtttccggacgttggcgagggcctgcacgaagcacaggtcgtcgcctgg
cacgtccacgagggcgacgcgatcgaacgggatgccccgctggtcgacgtcgagactgac
aagtcggtggtgaccattccggcgccggtggccgggacggtcgagaagatcctcttccac
gagggcgacaccgttcacgttggtgaggtcgtcgtggtgttcggcgacggcagcgcgccg
gcgccatcgccgctccagccgacggcgtccccggctcatgtcccggcaccgccggttgct
ccggcgccgacgcccgcgagtgagccgctagcgcgtggggtcgatcgaggcatcgtgctc
gcgacgcctgccgtgcggcgcctcgcgcgagagctcggtgtcgaccttgcgagcgtcgtc
gggagcggagaacgcggccgagtcctcgccgacgacgttcggcgcttcgcggcgtcgccc
gagagcaccgagtcggccgtggccgcggtgtcgacgctgtcgaccggggcgcctcgcgcc
gatcgaggcgccggcgacgacggtgtcgcgccgctggccgtcgaggccgacgagcgtcgg
ccgctggtcgggatccgcaagcgtatcgcggagaacatggcgcgttcgtggtcgcacgct
gtgcaggtcacggtcgtcgaggaggtcgtcgtcgacgagctcgtggcgctccgtgagcgc
atcaacgcccacctcggcgagcaacgcatcagctacctgccgattttcgtgaaggccgcc
gcgagcctgctggcgcgcttcccagagctcaacgcatcgctcgacgaggaggcatccgag
ctcgtctaccacgcccatcgcaacatcgggatcgccgtcgacgatccccaaggtctcatg
gtgcccgtggtgcgcgatgccgatcgccgctcgatcagggagctcggcctcgagctcgag
cgcctcatccaaggtgcccgggcgcacaccttggggccgcgggacctgaccggctcgacc
ttcacgatcacgaacttcggttcgatcggcggcatcgtggcgacgccgatcatcaactat
cccgacgtcgcgattctgggcgtcgggccgattcgccgccgtgctgtcgtgggcccggac
gacgtcatcgtgccggcgtcggtgctgttcgtctcgttgaccttcgaccatcgcgtggtc
gacggcgggacggcctcgcgctttctcgtcgcgctctcggagctgctccgagacccggct
gccctcgtcgcggagctcgtgtga

DBGET integrated database retrieval system