KEGG   Acidimicrobium ferrooxidans DSM 10331: Afer_0851Help
Entry
Afer_0851         CDS       T00956                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afo  Acidimicrobium ferrooxidans DSM 10331
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:afo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:afo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:afo00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:afo00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:afo00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:afo00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
873338..874165
Genome map
AA seq 275 aa AA seqDB search
MSRRAPEPEPQAGSGRVRLVVANWKLHHTHLEAIAFLERLWHLLDVEDYRRAEIAICPAF
TALRSAQLTIETDGMPYRLGAQDVFWEPSGAYTGEVSVPMLAKLDVKYVIVGHSERRRLF
GETDDVVAKKAAAVASGGLVPIVCVGEVAEERAGGTTEAVLERQLDTVLTTYPVEALGEL
VIAYEPVWAIGSGTPATPEDAEHVARFLRDRLARRASEAVAARVRILYGGSVDVGNAVAF
LAQADIDGLLVGGASLDPERFAQLLGGRPRIASTS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggcgggctcccgagcccgagccccaggcgggatccggacgggtgcgtctcgtc
gtcgccaactggaagctgcaccacacgcacctcgaagccatcgcgttcttggagcggctg
tggcacctgttggatgtcgaggactaccggcgcgcggagatcgcgatctgccctgcattc
acggcgctgcggtcggcgcagctgacgatcgagaccgatggcatgccctatcggctcggt
gcccaagacgtcttctgggaaccctcgggggcctacacgggggaggtgagcgtccccatg
ctcgccaagctggacgtcaagtacgtgatcgtggggcactctgagcgccggcgcttgttc
ggcgagaccgacgacgtggtcgccaagaaggcggcggcggtcgcgtccggtgggttggta
ccgatcgtgtgcgtgggtgaggtcgccgaagagcgcgctgggggtaccacggaggccgtg
ctcgagcgccaactcgacacggtgctcacgacgtatccggtcgaggcgctcggagagctc
gtgatcgcctacgaacccgtctgggcgatcggttcgggaacgcccgcgacgcccgaagac
gccgagcacgtcgctcgcttcctccgggaccgcctcgcgcgccgggcgagcgaggcggtg
gctgctcgcgtccgcatcctctacggtggctccgtcgacgtgggcaatgcggtcgcgttc
ctcgcgcaggccgacatcgatggtctcctcgtcgggggtgcctcgctcgatccggagcgt
ttcgcgcagctgctcggcggccgaccccgcatcgcgtcgacgtcctag

DBGET integrated database retrieval system