KEGG   Acidimicrobium ferrooxidans: Afer_0851Help
Entry
Afer_0851         CDS       T00956                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Afer_0851
   01230 Biosynthesis of amino acids
    Afer_0851
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Afer_0851
   00051 Fructose and mannose metabolism
    Afer_0851
   00562 Inositol phosphate metabolism
    Afer_0851
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Afer_0851
Enzymes [BR:afo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Afer_0851
Exosome [BR:afo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Afer_0851
  Exosomal proteins of bladder cancer cells
   Afer_0851
  Exosomal proteins of melanoma cells
   Afer_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
873338..874165
Genome map
AA seq 275 aa AA seqDB search
MSRRAPEPEPQAGSGRVRLVVANWKLHHTHLEAIAFLERLWHLLDVEDYRRAEIAICPAF
TALRSAQLTIETDGMPYRLGAQDVFWEPSGAYTGEVSVPMLAKLDVKYVIVGHSERRRLF
GETDDVVAKKAAAVASGGLVPIVCVGEVAEERAGGTTEAVLERQLDTVLTTYPVEALGEL
VIAYEPVWAIGSGTPATPEDAEHVARFLRDRLARRASEAVAARVRILYGGSVDVGNAVAF
LAQADIDGLLVGGASLDPERFAQLLGGRPRIASTS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggcgggctcccgagcccgagccccaggcgggatccggacgggtgcgtctcgtc
gtcgccaactggaagctgcaccacacgcacctcgaagccatcgcgttcttggagcggctg
tggcacctgttggatgtcgaggactaccggcgcgcggagatcgcgatctgccctgcattc
acggcgctgcggtcggcgcagctgacgatcgagaccgatggcatgccctatcggctcggt
gcccaagacgtcttctgggaaccctcgggggcctacacgggggaggtgagcgtccccatg
ctcgccaagctggacgtcaagtacgtgatcgtggggcactctgagcgccggcgcttgttc
ggcgagaccgacgacgtggtcgccaagaaggcggcggcggtcgcgtccggtgggttggta
ccgatcgtgtgcgtgggtgaggtcgccgaagagcgcgctgggggtaccacggaggccgtg
ctcgagcgccaactcgacacggtgctcacgacgtatccggtcgaggcgctcggagagctc
gtgatcgcctacgaacccgtctgggcgatcggttcgggaacgcccgcgacgcccgaagac
gccgagcacgtcgctcgcttcctccgggaccgcctcgcgcgccgggcgagcgaggcggtg
gctgctcgcgtccgcatcctctacggtggctccgtcgacgtgggcaatgcggtcgcgttc
ctcgcgcaggccgacatcgatggtctcctcgtcgggggtgcctcgctcgatccggagcgt
ttcgcgcagctgctcggcggccgaccccgcatcgcgtcgacgtcctag

DBGET integrated database retrieval system