KEGG   Acidimicrobium ferrooxidans DSM 10331: Afer_0876Help
Entry
Afer_0876         CDS       T00956                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
afo  Acidimicrobium ferrooxidans DSM 10331
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:afo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
897116..898609
Genome map
AA seq 497 aa AA seqDB search
MTTRILALDQGTTSSRAIVFDLDGTILGLGQHEFPQYYPQPGWVEHDPEEIWESQRQAIF
DALRAAGIAPGDLSAIGITNQRETTIVWDRQTGKPVMNAIVWQCRRTAPMCDELRAAGRE
DLVRSRTGLVIDAYFSGTKVAWILEHVPEARRLADEGRLAFGTVDAWLIWKLTGGRVHAT
DATNASRTMLFNIHTGEWDPELLEMLGVPASMCPTVVDSAGVVAETDPEIFGARVPIAGI
AGDQQAALFGQACIEPGMAKNTYGTGSFLLQTTGHDAVASHSGLLTTVAWSIGGERTYAL
EGSIFVTGAVVQWLRDGLRLIAHAEDTEAIAAEVPDTGGVVVVPAFVGLGAPVWDPYARG
TIVGITRGTTRAHIVRAALESMAYQTRDVVEAMAADSGQRLAILRVDGGAVRNNVVAQLQ
ADVLGIPVERPKVTETTALGAAYLAAVGVGAVAGPGGLRDVWQLERRFEPTWDEATRAAA
YRTWQRARDRARAWVEA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacccgtatcctcgctcttgatcaaggaacgacgagctctcgagcgatcgtcttc
gatctcgacggcaccatcctcggcctcggccagcacgagttcccgcagtactacccgcag
ccaggctgggtcgagcacgaccccgaggagatctgggagtcccagcgccaggccatcttc
gacgccctgcgcgccgccggcatcgcgccaggggacctcagcgcgatcggcatcaccaac
cagcgtgagaccaccatcgtgtgggatcgccaaaccggcaagccggtcatgaacgcgatc
gtgtggcagtgccgacggacggcgccgatgtgcgacgaactccgtgcggccggccgcgag
gatctggtccgttcccgtaccggtctcgtcatcgacgcttacttctcgggaacgaaggtg
gcctggatcctcgagcacgtgccggaggctcgtcgcctggcggacgagggccgattggcc
tttggcaccgttgatgcgtggctgatttggaagctcaccggcggacgggtgcatgcgacg
gacgccaccaacgcctctcggaccatgctcttcaacatccacaccggtgagtgggatccc
gaactgctcgagatgctgggcgtgcccgcgtcgatgtgcccgacggtcgtcgactccgca
ggcgtggtcgccgagacggaccctgagatcttcggtgccagggtgcccatcgccggcatc
gcgggtgatcagcaggccgctctcttcggccaggcgtgcatcgagccgggcatggcgaag
aacacctacgggaccgggtccttcctgctgcagaccacgggccacgatgcggtcgcgtcg
cactcgggcctgctcacgaccgtggcgtggagcatcgggggtgagcgcacctacgcgctc
gagggctccatcttcgtgaccggagccgtcgtccagtggctgcgcgacggactgcgtctc
atcgcgcatgccgaggacaccgaggcgatcgccgccgaggtccccgacaccggtggcgtc
gtggtggtccctgccttcgtggggctcggcgcaccggtgtgggacccgtacgcgcggggc
accatcgtcggcatcacgcgcgggacgacgcgggcacacatcgtgcgggccgcgctcgaa
tcgatggcctaccagacgcgtgacgtcgtcgaggcgatggcggccgactcgggccagcga
ctcgccatcttgcgggtcgacggcggtgcggtgcgcaacaacgtggtcgcacagctccag
gccgacgtgctcgggatcccggtcgagcgtccgaaggtcaccgagaccacggcgctgggt
gctgcctacctggcggcggtcggcgtgggtgcggtggcaggtcctggggggctgcgcgac
gtgtggcaactggagcggcgcttcgagccaacgtgggacgaggcgacgcgagccgcggcc
tatcgcacgtggcagcgtgcgcgggaccgcgcccgagcgtgggtcgaggcgtag

DBGET integrated database retrieval system