KEGG   Acidimicrobium ferrooxidans: Afer_1094Help
Entry
Afer_1094         CDS       T00956                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
afo00260  Glycine, serine and threonine metabolism
afo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afo01100  Metabolic pathways
afo01110  Biosynthesis of secondary metabolites
afo01130  Biosynthesis of antibiotics
afo01230  Biosynthesis of amino acids
Module
afo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Afer_1094
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Afer_1094
Enzymes [BR:afo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Afer_1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NanE His_biosynth ThiG PucR PcrB TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ACU54027
UniProt: C7LZ69
Position
complement(1139745..1140554)
Genome map
AA seq 269 aa AA seqDB search
MSGLGAHLRSRVERGRSVIVPYVCAGARDGWEDDVVALAEGGADAIEIGIPFSDPSMDGP
TIQRASEVALQRGTTVAGTIAALRNLVVGVPLVVMTYYNLLYHQGLERAAGRLAEAGVAG
VIIPDLSIEEAEPWWRAAREVGLETVQLVAPSTPPARMERIVRAAEGFVYAVGLMGVTGE
RDQLAETATEIAGRLAGRAELAVLVGIGVSSPEHAAAVVEAGADGAVVGSAIVRRVLEGA
PPAELGEFVRALHEAGDRAMEHRGRQPVA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcctcggtgcccaccttcgctccagggtcgagcgtggacggtccgtgatcgtc
ccgtacgtgtgcgctggcgcgcgcgacggctgggaagacgacgtcgtcgcgctcgcagag
ggtggtgcggacgcgatcgagatcggcataccgttctccgacccctccatggacgggccg
accatccagcgagccagcgaggtcgcgctccagcgaggcacgacggtcgccggtacgatc
gctgcgctccggaacctggtcgttggcgtgccgctcgtggtcatgacctactacaacctg
ctctatcaccaggggctcgaacgtgccgctggacgcctggccgaggccggcgttgcgggc
gtcatcatcccggatctgtcgatcgaggaggcggagccgtggtggcgggcggcgcgcgag
gtcggtctcgagaccgtgcagctcgtcgcgccatcgacgcccccggcgcgcatggagcgc
atcgtgcgcgctgcggagggcttcgtctacgcggtcgggttgatgggcgtcaccggtgag
cgcgaccagctcgccgagacggcgaccgagatcgccgggcggctcgccgggcgtgctgag
ttggcggtgctcgtcgggatcggggtctcgagcccggagcacgcggctgcggtcgtcgag
gccggtgccgacggcgcggtggtgggttcggcgatcgtgcgcagggtgctcgagggggca
ccaccggcggagctcggcgagttcgtgcgtgcgttgcacgaagcgggggatcgtgcgatg
gagcatcgaggacgtcaaccagtagcgtag

DBGET integrated database retrieval system