KEGG   Acidimicrobium ferrooxidans: Afer_1095Help
Entry
Afer_1095         CDS       T00956                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Afer_1095
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Afer_1095
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Afer_1095
Enzymes [BR:afo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Afer_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1140551..1141738)
Genome map
AA seq 395 aa AA seqDB search
MTMIEPKGTNAPDATGRFGDFGGRFVPESLMPAVLELESGFRAAWADVAFRDEYARLLAT
YAGRPTLLYRAERFSELVGREVWLKREDLAHTGSHKINNVLGQALLARRLGKRRLIAETG
AGQHGVATATAAAFLGLEARVYMGAVDAERQALNVFRMRLLGAEVVEVTAGSRTLKDAVN
EAMRAWVAELGDTHYCIGSVMGPHPYPWMVREFQRVIGDEAREQFAAQAGGVPELVVACV
GGGSNAAGTFTGFVETSARLVGVEPAGGAAIGRGGPGVVHGMHSMLLQDEDGQVREAESI
SAGLDYPGVGPEHAYWASTGRVSYEPVGDDEVVDALVALSRTEGIVPALESAHALAWVLR
EGSARTQPGDRIVVTLSGRGDKDAETVAAYLGGRR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgatcgagcctaaggggacgaacgcgccggacgcgactggtcgcttcggcgac
ttcggaggccgcttcgtcccggagtcgttgatgccggcggtgctcgagctcgagagcgga
tttcgagctgcgtgggccgacgtcgcattccgggacgaatacgcgcgtctgttggcgacg
tatgccggccggcccaccctgctctatcgggcagagcgcttctcggagctcgtcgggcgc
gaggtctggctgaagcgggaggacctcgcccacaccggctcgcacaagatcaacaacgtg
ctcggtcaggcgctgctggcgcggcggttgggcaagcggcgactcatcgccgagacggga
gccggccagcacggtgtcgcgacggcgacggcagcggcgttcctcgggctcgaggcgagg
gtgtacatgggagcggtcgacgccgagcgccaggcgctcaacgtctttcggatgcgactg
ctcggtgcggaggtcgtggaggtcacggcgggaagtcgcacgctcaaggacgcggtgaac
gaggcgatgcgcgcctgggttgccgaactcggggacacgcactactgcatcggttcggtc
atgggtccgcatccgtacccttggatggtgcgcgagttccagcgtgtcatcggcgacgag
gcgcgcgagcagttcgctgcccaggccggtggcgtccccgagctcgtcgtcgcctgcgtc
ggcggtggttccaacgcggccgggaccttcacgggcttcgtcgagacgtcggcacggctc
gtcggggtcgagccggccggtggtgccgccatcggacgcggggggccaggggtggtgcac
ggcatgcactccatgctcctccaggacgaggacggtcaggtgcgcgaggccgagtccatc
tcggccggtctcgactaccccggggtcggtccggaacacgcctactgggcgagcacgggc
cgcgtgagttacgaaccggtcggcgacgacgaggtcgtcgatgcgctggtggcgttgtcg
cggacggagggcatcgttccggccctcgaatcggcccacgctctcgcgtgggtgctgcgt
gagggatcggcgcgcacacagcccggtgaccgcatcgtggtgactctgtcaggacggggc
gacaaggacgcggagacggtcgctgcgtacctcgggggtcggcggtga

DBGET integrated database retrieval system