KEGG   Acidimicrobium ferrooxidans: Afer_1097Help
Entry
Afer_1097         CDS       T00956                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
afo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afo01100  Metabolic pathways
afo01110  Biosynthesis of secondary metabolites
afo01130  Biosynthesis of antibiotics
afo01230  Biosynthesis of amino acids
Module
afo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Afer_1097
Enzymes [BR:afo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Afer_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACU54030
UniProt: C7LZ72
Position
complement(1142323..1143138)
Genome map
AA seq 271 aa AA seqDB search
MADYLTDIVAYHRRRAALDDESFTSLLAGLDAIEPRPSLRSALLASAGLGVVAEFKRRSP
SKGWFVEPETDVATRVSAYERAGAVAVSVLTDTPHFGGTLADLERAAQHVELPIVRKDFI
VDARELLRARRAGASAVLLIAAALQPEEVASLAGVAHDVGLEVLLEIHELSELELAELAA
ADVVGVNQRDLTSFRVDTDRARRVLAALPPGAARLAESGVRGPDDLAGLVGFDGVLIGEA
CMRARDPYATVRALVERGASVHQDLRHHESV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggccgactacctgaccgacatcgtcgcctaccatcgtcggcgtgccgccttggacgac
gagtcgttcacgagtctgctcgccggactcgacgccatcgagccccgcccgagccttcgc
tcggcgctcctggcatcggctggcctcggtgtcgtcgctgagttcaagcgccgcagcccg
tcgaagggctggttcgtcgagccagagaccgacgttgcgacgcgagtctcggcctacgag
cgagctggggcggtcgcggtcagcgtgctcacggacacaccgcacttcgggggcaccctc
gctgacctcgagcgagctgcgcagcacgtcgagcttcccatcgtgcgcaaggacttcatc
gtcgacgcgagggagcttctccgggcccgtcgcgcgggagcgagcgcggtcttgctgatc
gcggcggcgctccagccggaggaggtcgcatctctcgctggtgtcgcccacgacgtcggg
ctcgaggtgctcctcgagatccacgagctcagcgagctcgagcttgctgagcttgccgcc
gcggacgtcgtcggcgtcaatcaacgcgacctgacgagttttcgcgtggacaccgatcgg
gcgcgtcgcgtgctcgcggcgctcccgccgggcgcggccaggctcgctgagtcgggcgtg
cgtggtcccgatgatctcgcggggctcgtgggcttcgacggtgtcctgatcggtgaggcc
tgcatgcgtgctcgggacccctacgcgaccgtccgggcgctcgtcgagcgaggtgcgagt
gttcatcaagatctgcggcatcacgaatcagtctga

DBGET integrated database retrieval system