KEGG   Acidimicrobium ferrooxidans DSM 10331: Afer_1111Help
Entry
Afer_1111         CDS       T00956                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
afo  Acidimicrobium ferrooxidans DSM 10331
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afo01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:afo00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1157349..1158647)
Genome map
AA seq 432 aa AA seqDB search
MASLTLVDLRETTGALRRDDLPGVALPVEGPRALVREIVQSVRTGGDGALADLTERFDGV
RPRALVLGREAMAAAYERLDRRLAEALRVARDRVREAYEAERPAASSLVADGIEVRRRIV
PVERAGCYVPGGQARYPSSVVHTATVARVAGVRDVVVATPPLPDGGLDDATLAACHLAGV
DTVLLAGGAQAVAALAYGTESLERVDVIVGPGNLFVSLAKQEVAADVGVPGAFAGPSEVV
VVADGSLEPRVAAIDVAVQAEHGPHGLAWLVTWDARWAEQVLEELAAYVEASPRRAQLES
TLEAHGYLALVRDRDQARLVADAIAPEHLELLYDQAVRDADRVRHAGVVFVGRAASAAFG
DYVAGPSHVLPTAGTARFASVLGLEDFQRRLHVVEVHDEALSRLGWAVEALADAEGLVAH
ADSIRIRREAGW
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgctgacccttgtcgatcttcgcgagacgactggcgccctgcggcgcgacgat
cttcccggggtggcgttgccggtggaagggccacgggcactcgtgcgtgagatcgtccag
agtgtgcgcacgggtggggacggggccctggcggatctgacggagcgcttcgacggcgtg
cggccgcgagcgctcgtcctcggtcgcgaggcgatggccgccgcctacgagcgcctcgat
cggcggctggccgaggcgttgcgggtcgctcgcgatcgcgtgcgcgaggcctacgaggcc
gagcgcccggcggcgtcgtcgctggtggccgacggcatcgaggtgcgccgcaggatcgtc
ccggtggagcgagccggctgctacgtgcccgggggacaggctcgctatccctcaagcgtc
gtgcacaccgcgacggtggctcgggttgcgggcgtacgcgatgtcgtcgtcgccacaccg
ccgttgcccgacggtggcctcgacgacgcgacgctcgccgcctgtcatctggccggggtc
gacaccgtgctgctcgccggtggcgcgcaggcggtcgcggcgctcgcctatggcacggag
tcgctcgagcgtgtcgacgtcatcgtgggtccgggcaacctcttcgtctcgctggccaag
caagaggtcgcggccgacgtcggtgtgccgggtgccttcgccggcccctcggaggtggtc
gtggtcgcggacggctcccttgagccgcgcgtcgcggcgatcgacgtcgcggtccaggcc
gagcacggcccccatggcctggcctggctcgtgacctgggacgcccgctgggccgagcag
gtgctcgaagagctcgcggcctacgtggaggcgagtcccaggcgcgcccagctcgagagc
acgctcgaggcgcacggctatctcgcgctcgtgcgcgaccgggatcaagctcgcctggtg
gccgacgcgatcgcgcctgagcacctcgagctgctctacgaccaggcggttcgggacgct
gatcgggtccgccacgccggtgtggtcttcgtcggacgagcagccagtgccgcgttcggg
gactacgtggccggcccctcacacgtcctgccgacggctgggacggcgcgttttgcgagc
gtgctcggcctcgaagacttccagcgtcgcctccacgtcgtcgaggtccacgacgaggcg
ctcagtcggctgggctgggccgtcgaggcgctcgccgacgcagaggggctcgtcgcgcac
gcggactcgatccgcatccgtcgggaggccggatggtga

DBGET integrated database retrieval system