KEGG   Acidimicrobium ferrooxidans: Afer_1201Help
Entry
Afer_1201         CDS       T00956                                 

Definition
Glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Afer_1201
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Afer_1201
Enzymes [BR:afo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Afer_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1255059..1255541)
Genome map
AA seq 160 aa AA seqDB search
MFPYDLVMERLDGTKEELSAYRGKVLLVVNVASRCGLTPQYEGLVELYHARRDDGFVVLG
FPCNQFLGQEPGTAEEIETFCRTTYGVDFPMFAKIEVNGEGRHRLYASLCEVPDGDGVAG
DVQWNFEKFLVSRDGERIERFRPTVEPQDPMLVGAIDALL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgttcccgtacgatttggtgatggagcggctggacggcacgaaggaggaactctccgcc
tatcggggcaaggtgctgctcgtcgtgaacgtcgcgtcgcgctgcggtctcacgccgcag
tacgaggggctcgtcgagctctaccatgcacggcgagacgatggtttcgtcgtgctcggc
tttccgtgcaatcagttcctcggccaagagcccgggaccgcagaggagatcgagacgttc
tgccggaccacctacggggtcgacttcccgatgtttgcgaagatcgaggtcaacggcgag
gggcgccatcgcctctacgcgagcctctgcgaggtccccgatggtgatggcgtggcgggt
gacgtgcagtggaacttcgagaagttcctcgtctcgcgcgacggagagcggatcgagcgg
tttcgccccactgtcgagccacaggacccgatgctcgtgggggccatcgacgccctcctg
tga

DBGET integrated database retrieval system