KEGG   Acidimicrobium ferrooxidans DSM 10331: Afer_1216Help
Entry
Afer_1216         CDS       T00956                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
afo  Acidimicrobium ferrooxidans DSM 10331
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:afo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1273843..1274412)
Genome map
AA seq 189 aa AA seqDB search
MIGWLHGRVASAGRSPVVIDVAGVGYEVHVTAPWATLLRRDDECELWIRTIVRADAIALY
GFASQAEREAFDALIGVSGVGPQLALGILGGIEGDELWTAIATEDLGRLTAIAGVGPKTA
KRVVLELAPTAKRLAPVTGVPMSQEVSALRAALGELGFRPGEIDAVVRRCPGDLDFEAQV
RWALKELAR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggtggctccacggccgcgtggcgagcgccgggcgctcaccggtcgtgatcgat
gtcgctggcgtcggctatgaagtgcacgtgactgctccgtgggcgacgctgctccgccgc
gatgatgagtgcgagctctggatacgcacgatcgtgcgggcggacgccattgccctctac
ggcttcgcgagccaggcggagcgagaggcgttcgatgcgctcatcggggtgagtggggtc
ggcccgcagctcgcactcggcatcctcggcgggatcgagggtgacgagctctggaccgcc
atcgccacggaggacctcgggcggctcaccgcgatcgccggcgtcggaccgaagacggcc
aagcgggtcgtcctcgagcttgcgccgaccgcgaagcgcctcgcgcccgtgacgggagtg
cccatgagccaggaggtgtccgcgctgcgggctgcgctcggcgaactcggattccggcca
ggcgagatcgacgccgtcgtgcggcggtgccccggcgaccttgacttcgaggcccaggtg
cgctgggcgctcaaggagctggctcgatga

DBGET integrated database retrieval system