KEGG   Acidimicrobium ferrooxidans DSM 10331: Afer_1304Help
Entry
Afer_1304         CDS       T00956                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
afo  Acidimicrobium ferrooxidans DSM 10331
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:afo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1356819..1357664)
Genome map
AA seq 281 aa AA seqDB search
MTVAPAPSLVARGRVLDASRPLVMGIANRTPDSFFDHGSYFAFDRFLAHVEGLVEAGADI
VDIGGVKAGAGPEVSLSEELDRVVPAVEAVARRFDVTISVDTWHSEVLRASLEAGAHIGN
DISGFGDPAYLEVAAAGDAAVVATHIRLAPRVDDPDPHYDDLVETVVGFLAERAERALAA
GLGPSQVILDAGFDLGKTTSQSLALLAATDRLVELGYPVLVATSNKGFVGETLGLEVGER
REASIAAAAIAYLRGARLFRMHDVRGARRALDTLAAISASA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgccccggcgccgtcgctcgtggcacgcggtcgcgtgctcgatgcgagccgt
cccctcgtgatggggatcgccaatcgcacccctgactcgttcttcgaccacgggtcctac
ttcgccttcgatcgcttcctcgcccacgtggaggggctcgtcgaggccggggcggacatc
gtggacatcggtggagtcaaggcgggcgctggccccgaggtgagcctctccgaggaactc
gatcgggtggtacctgcggtggaggccgtggctcgtcgttttgacgtgaccatctccgtc
gacacgtggcacagtgaggtgctccgggcgtcactcgaggcgggcgcccacatcggcaac
gacatctctggctttggcgaccctgcctatctcgaagtcgctgcggcgggcgatgccgcc
gtcgtcgcgactcacattcgtctcgccccacgcgtcgacgaccccgatccgcactacgac
gatctcgtcgagacggtcgttgggttccttgccgagcgggcggagcgggcgctcgccgcg
ggcctcggcccatcccaggtgatcctcgacgctggtttcgacctcggcaagaccacgtcg
cagtcgctcgccctcctcgccgccaccgatcgcctcgtcgagctcggctatccggtgctg
gtcgccacctcgaacaagggcttcgtcggcgagacacttgggctcgaggtcggggagcga
cgcgaggcgtccatcgctgcagccgcgatcgcctacctacggggcgcgcgcctgttccgg
atgcacgacgtgcgtggagcgcgtcgtgcgctcgacacattggcggcgatctcggcgagc
gcctag

DBGET integrated database retrieval system