KEGG   Acidimicrobium ferrooxidans: Afer_1393Help
Entry
Afer_1393         CDS       T00956                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
afo  Acidimicrobium ferrooxidans
Brite
Enzymes [BR:afo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Afer_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1449743..1452724)
Genome map
AA seq 993 aa AA seqDB search
MKLHFEPNLDYQWQAIEAVCDLFRGQEICRTEFTVTRDPADTQMRLGVAQNELGIGNRLM
LLDDELLKNLNDIQLRNGLPPSESLASGDFTVEMETGTGKTYVYLRTIFELNKRYGFTKF
VIVVPSIAIKEGVYKTLQITEDHFKSLYSGVPFDYFLYDSSKLGQVRNFATSANIQIMVM
TVGAINKKDVNNLYKESEKTGGEKPIDLIKATRPIVIVDEPQSVDGGLQGRGKEALDAMN
PLCTLRYSATHVDKHHMVYRLDAVDAYEKRLVKQIEVASATVEHAHNKPYVRLVSVSNKR
GIISAKVELDVKTDSGGVKRREVKVQDGDDLEEIAGRAIYAGYRIGEIRVEKGNEYMELR
VPGGEHFLKPGQAWGDVDMLAVQRQLIRRTIREHLDKEMRLLPKGIKVLSLFFIDEVAKY
RQYDAAGNPVKGDYARIFEEEYRRAANLPEYEPLFKGVDVSREAEKVHNGYFSIDKKGGW
TDTAENNEAGRDNAERAYNLIMKDKEKLLSLETPIKFIFSHSALREGWDNPNVFQICTLR
DIRTERERRQTIGRGLRLCVNQYGERVRGFDVNTLTVIATESYEDFAENLQKEIEEDTGI
RFGIVEADQFAHIVVTDANGKASPLGIERSKALWESFKAYGYIDAKGRVQDSLRRALRDG
TVEVPEEFAAQRDQITDVLKKAAGRLEIKNADERRQVRVRGEVHISDEFKALWDRIKDKT
TYRVKFDNEALVEACIKALKEMPAIPKVSLQWRKADIAIGKAGVVAAERERGAPVGLEET
DIDLPDLLTELQDRTQLTRRTIYRVLTESRRLADFKRNPQRFIELAAETINRCKRKAMVD
GIKYQRLGDEHYYARELFESEELTGYLKNLFEAKKSVYEQVVYDSDTELTFAQQLEYNRD
IKVYAKLPGWFTVPTPLGGYNPDWAVVVEQEGEERLYFYFVVETKGSVVADDLRGKEKAK
IDCGKAHFEALKDRENPAQYKVASSVDDLFIRE
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcactttgaaccgaacctcgactaccagtggcaggccatagaggctgtgtgc
gatctgttccgcgggcaggagatctgccgcaccgagttcacggtcacgcgcgatcccgcg
gacacccagatgcgcctcggcgttgcgcagaacgagcttggcatcggcaaccgtctgatg
ttgctcgacgacgagctgctcaagaacctgaacgacatccaactccgcaacggcctgccg
ccctcggaatcactcgcatcaggtgacttcactgtggagatggagaccggcaccggcaag
acctatgtgtatctgcgcaccattttcgagctgaacaaacgctacggctttaccaagttc
gtcatcgtggtgccgtcgattgccatcaaggagggtgtgtacaagacgcttcagatcacc
gaagaccatttcaagagcctgtactccggcgtgcctttcgactatttcctctacgactcc
tccaaactcgggcaggtgcgcaacttcgccaccagcgcgaacatccagatcatggtgatg
accgtcggggccatcaacaagaaagacgtcaacaacctctacaaggaaagcgagaagaca
ggcggtgaaaagcccatcgacctgatcaaggccacccggcccattgtgatcgtcgatgag
cctcagagcgtggacggcggccttcaggggcgcggcaaggaagcgctcgacgccatgaat
ccgctttgcaccctgcgttactcggccacccacgtggataagcaccacatggtctaccgg
ctggacgctgtggacgcctacgagaagcggctggtcaagcagatcgaggtggcctcggcc
acggtcgaacatgcccacaacaagccctacgtgcgcctggtttcggtgtcgaacaagcgc
ggcatcatttcagcgaaggtcgagctggacgtgaagaccgacagcggtggggtcaagcgg
cgggaggtgaaggttcaggacggcgacgacctggaagagatcgccggccgcgcgatctac
gccggctaccgtatcggcgaaatccgggtcgaaaagggaaatgagtacatggagctgcgc
gtccccggcggcgagcacttcctcaagccggggcaggcctggggagacgtggacatgctg
gccgttcagcgccagctgattcgccgaaccattcgcgagcacctggacaaggagatgcgc
ctgctaccaaagggcatcaaggtgctgtcgctcttttttatcgacgaagtcgccaagtat
cgccagtatgacgcggccgggaaccccgtgaaaggtgattacgcccgcatcttcgaggaa
gagtaccgacgagctgccaacctgccagagtatgaaccgctcttcaaaggggtggatgtg
agccgcgaagccgagaaggttcacaacggctacttttccatcgacaagaaaggcggctgg
acggatactgccgagaacaacgaggcgggccgcgacaacgccgagcgggcctacaacctc
atcatgaaggacaaggaaaagctcctctccctcgagacgccgatcaagtttattttctcg
cactcggcgctgcgcgaaggctgggacaaccccaacgtctttcaaatctgcaccctgcga
gacatccgtacggagcgcgaacggcggcaaaccatcgggcgcggcttgcgtttgtgcgtg
aatcagtacggcgagcgtgtgcggggcttcgatgtcaatacactgaccgtgatcgctacg
gagagctacgaggacttcgccgagaacttgcagaaggaaatcgaggaggataccggcatc
cggttcggcattgtcgaggcggaccagttcgctcacatcgtggtcaccgatgcgaatggc
aaagcctcgccgctcggcatcgaacggtcgaaggcgttgtgggagtccttcaaggcctat
ggctacatcgacgccaaaggacgggtgcaggattcactcagaagggcactcagggacggc
accgtggaagtgcccgaggagttcgccgcgcagcgtgaccaaatcacggatgtcctcaag
aaggcggccgggcggcttgagatcaagaacgccgacgagcgtcggcaggtgcgtgttcgc
ggggaggtccatatcagtgatgagttcaaggcgctgtgggaccgcatcaaggacaaaacc
acataccgggtgaaattcgacaacgaagcgctcgtggaggcgtgcatcaaagcgctcaaa
gaaatgccggcgatcccgaaggtgagcctccagtggcgaaaggcggatatcgccatcggc
aaggccggcgtggtagccgccgagcgcgagcgtggggcgcccgtagggctcgaggaaacg
gacatcgatctgccggacctgcttaccgagcttcaagaccggacccaactcacgcgccgc
acgatttaccgcgtcctgacggaaagtaggcgtctggccgacttcaagcgcaatccccag
cggttcatcgagctggcggcagagactattaaccgctgcaagcggaaggcgatggttgat
ggcatcaaataccagcgcctgggtgacgagcactactacgcgcgggagctgttcgaaagt
gaggagctgaccggctacctgaagaatctcttcgaggccaagaagtcggtctatgagcag
gtggtctacgactccgacaccgagctaacgtttgcccagcagctcgagtacaaccgtgat
atcaaggtctacgcaaaactcccgggctggttcaccgtgccgacgccgctgggcggatac
aaccctgactgggcggtggtcgtcgagcaggaaggcgaggagcgcctctacttttacttt
gtcgttgagaccaagggcagtgtggtcgccgacgacttgcgtggcaaggaaaaggcgaag
attgactgcggcaaggcgcatttcgaggcgctcaaggatcgcgagaacccggcacagtac
aaagtagcgagttcggttgatgatctatttatccgagagtga

DBGET integrated database retrieval system