KEGG   Acidimicrobium ferrooxidans: Afer_1641Help
Entry
Afer_1641         CDS       T00956                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
afo00010  Glycolysis / Gluconeogenesis
afo00620  Pyruvate metabolism
afo00640  Propanoate metabolism
afo00680  Methane metabolism
afo01100  Metabolic pathways
afo01110  Biosynthesis of secondary metabolites
afo01120  Microbial metabolism in diverse environments
afo01130  Biosynthesis of antibiotics
afo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Afer_1641
   00620 Pyruvate metabolism
    Afer_1641
   00640 Propanoate metabolism
    Afer_1641
  Energy metabolism
   00680 Methane metabolism
    Afer_1641
Enzymes [BR:afo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Afer_1641
Lipid biosynthesis proteins [BR:afo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Afer_1641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACU54557
UniProt: C7M0P9
Position
complement(1733518..1735488)
Genome map
AA seq 656 aa AA seqDB search
MSEPMPELPPMVRTAELVEPSLSPSGRLPVSNVDEFRALYERSIEDLGGYWRSVAATFEW
IDGFDEAPALEGSLADGFRFFAGARMNVSVNCIDRHARREPERVAIRWIGEDGAERSWTY
QELASETARMAAALTDLGVTKGDVVAIFLPNLLETFAAVHACYRIGAIYNIIFSGFSAQA
LFDRIVDTGAKVVITADGTYRRGRRIPLKETLDGILDRLPSVRNVIVVRRLGDGEVPMQP
GRDHAWDELIAAHPDGAEPVPVEANEPGFIIYTSGTTAKPKGLVHAGVGFLIGTYHNVQW
ALDLGPEDVYWCTADTGWLTFPIFELVGGLAAGATMLAYEGALDYPEPDRAYDIIERYRV
TKVFTAPTFLRMLARAGASWAERHDLSSLRLISLVGEPLDATTWHWVREHVGTGTVEINN
TYGQSETGSAWTSSAVGITPAKPGSCGMALPGHRFDVVDDEGATVGRDRVGYLLLTAPFP
TLARSIWGDPARYRAQYFTRFGAERYDTADAALLDHDDHVWVVGRVDGVINVAGHRLSTM
EMESALLLVPGVAEAAVVGVSDALKGQVPVAFVTVAAGATGVDEATCAAALEREIGPIAR
PGAVYVLSTMPRTRSGKIVRRLLAELVVDGKATGDVTGLEDPEVLARIQAELARGA
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccaatgccagagctacccccgatggtgcgaaccgccgaactggtggagccg
tccctgtcaccgtctggtcgactgccggtctcgaacgtcgacgagttccgagcgctctac
gaacgctcgatcgaggatctcgggggctactggcgttcggttgcagccacgttcgagtgg
atcgatgggttcgacgaagcccccgccctcgagggcagccttgccgatggatttcggttc
tttgccggggctcgtatgaacgtgagcgtgaactgcatcgatcgccatgcgaggcgcgag
ccagagcgcgtggcgattcggtggatcggggaggatggcgccgagcgcagctggacgtac
caggagctcgcctccgagaccgcacgcatggcggccgcgctcactgatctcggcgtgacg
aagggcgacgtcgtcgcgatcttcctgccgaacctgctcgagacgttcgccgcggtccac
gcgtgctaccggatcggcgccatctacaacatcatcttctctggcttctcggcgcaagcg
ctgttcgatcgcatcgtcgataccggggccaaggtggtgatcaccgcagacggcacctac
cgccgggggcggcgtatcccattgaaggagaccttggacggcatcctggatcggttgccg
tcggtgcgcaacgtcatcgtcgtgcgtcggctcggcgacggtgaggtcccgatgcaaccg
gggcgcgatcacgcatgggacgaactcatcgccgcgcatccggacggagcggagccggtg
ccggtcgaggcgaacgagccgggcttcatcatttacacctcgggcacgacggccaaaccc
aaggggctcgtgcacgcaggcgtgggctttctcatcgggacctaccacaacgtccagtgg
gcgctcgacctcgggccggaggacgtgtactggtgcaccgcagacaccggatggctgacc
ttcccgatcttcgagctcgtcggtggcctcgccgccggggcgacgatgctggcctacgaa
ggtgcgctggactatccggagcccgatcgcgcctacgacatcatcgagcgctaccgcgtc
acgaaggtcttcaccgccccgacgttcttgcgcatgctcgcgagagcgggcgcgagctgg
gcagagcgccacgatctctcgtcgctgcgtctgatctcgctcgtcggcgagccgctcgac
gcgacgacctggcactgggtgcgtgagcacgttggcacgggcactgtggagatcaacaac
acctacggacaatccgagaccggttcggcgtggacctcgagtgccgtgggcatcacgccc
gccaagcccgggtcgtgcgggatggcgctccctggtcatcggttcgacgtcgtcgacgat
gaaggcgcaacggtgggtcgagaccgagtcggctacctgctgctcacggcgccgttcccg
acgctggcgcggtcgatctggggggatccggcgcgctatcgggcgcagtacttcacgcgc
ttcggtgcggaacgctacgacaccgccgacgccgccctcctcgatcacgatgaccacgtc
tgggtcgtcggccgcgtcgatggtgtcatcaacgtcgcgggacaccgactctcgacgatg
gagatggagagtgcgctcctcctcgtaccgggtgtggccgaggcggcagtcgtcggggtc
agtgacgcactgaagggccaggtccccgtcgccttcgtgacggttgccgccggcgccacc
ggtgtcgacgaggccacgtgtgctgcggcgctcgagcgcgagatcggtccgatcgcgcgc
cctggcgcggtgtacgtcctgtcgacgatgccgcggactcgatcgggcaagatcgtgcgc
cgcctgctcgccgaactggtcgtcgatggcaaggcgaccggtgatgtcaccggcctcgag
gaccccgaggtccttgcccggatccaggccgaactggcgaggggagcatga

DBGET integrated database retrieval system