KEGG   Acidimicrobium ferrooxidans: Afer_1702Help
Entry
Afer_1702         CDS       T00956                                 

Definition
aspartate/ornithine carbamoyltransferase carbamoyl-P binding domain-containing protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Afer_1702
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Afer_1702
Enzymes [BR:afo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Afer_1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1789863..1790795)
Genome map
AA seq 310 aa AA seqDB search
MSATFLGVEQLDAGRLGVLGARVDELVHGAAASRCLEGRRVALLFLEPSTRTALSFEAAI
DRLGGRTVRIDPESSSLVKDESLRDTLRVLAAQGTSGVVVRAPWVGTADVVARFFDGIVV
NAGDGVGQHPTQALQDVCVLARTRGGRADAFGALEGCRVAIVGDLRHSRVARSVGRLLAS
VGAEVVGVAPREWSLDPKALGAVGVTDGIDDVLDEVDVFYMLRIQHERVGANERVDLSGY
RARFQLSGHRLERARPDAVVLHPGPVNRGVELDDIVLSSPRMLDGLQYAYGVPTRVAVLE
ALAEEAGWGL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaacgttcctgggggtcgagcagctcgatgcggggcgccttggcgtgctgggc
gcgcgtgtcgacgagctcgttcatggcgcggcggcgtcgcggtgtctggaggggcgacgg
gttgcgttgctgttcctggagccgtcgacgcgtacggcgctgtcgttcgaggctgcaatc
gatcggctcggcgggcggaccgtccgcatcgatccggagagcagctcgctcgtcaaggat
gagagtcttcgcgacacgttgcgcgtgctggctgcgcaggggacgagtggcgtggtcgtg
cgggctccgtgggttggtacggccgacgtggtagccagattcttcgatggcatcgtcgtc
aacgctggcgacggtgtcggtcagcatccgacgcaggcgctccaagacgtctgcgtcctt
gctcggactcggggcgggcgtgcggatgcgtttggcgcgcttgaggggtgtcgggtggcg
atcgtgggtgatctgcgccactcgcgcgtcgcgcgttcggtagggcggcttctcgcttcg
gtgggggcggaggtggtcggcgtcgctccccgtgagtggtcgttggatccgaaggccctt
ggtgccgtgggcgtcacggatggaatcgatgacgtcctcgacgaggtcgacgtcttctac
atgctccgtatccagcacgagcgcgtgggagcgaacgagcgcgtggatctgtcgggctat
cgggcgaggtttcagctgagcgggcatcgcctggagcgtgcgcggcccgatgccgtggtg
ctccatcccgggcccgtcaatcggggggtcgaattggacgatatcgtgctctcgtcccct
cggatgctcgatggcctgcagtacgcctacggtgtgcccactcgggtcgccgttctcgaa
gcgctcgccgaggaggcagggtggggattgtag

DBGET integrated database retrieval system