KEGG   Acidimicrobium ferrooxidans DSM 10331: Afer_1816Help
Entry
Afer_1816         CDS       T00956                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
afo  Acidimicrobium ferrooxidans DSM 10331
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:afo00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:afo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1901140..1902603)
Genome map
AA seq 487 aa AA seqDB search
MLTLRDLHGLVPSARLVGDPSVAIADITLDSRSVSPGAMFCATRGSRFDGHDFVSDAIAR
GAVALLVQHEVALDIPQLVVPSVRHAIGGLVAGFFGRPSERLDLVGITGTNGKTTTSYFI
DSILSLAGRRTGLIGTIEARFGDSNRPSMFTTPEAPELHRLLRQMVDDGVDSVVMEVSSH
GIDQHRIDGTSFRIGVFTNLSPEHLDYHGTIEQYYAAKAQLFLPERTKQAVIGTDTEWGV
RLATQVRIPAVTYGPAPFSDYRVEDVRYDEYGTIFTVVVGGRRRWRLRVPIYGIHNAYNA
AAAVAVAEALGIEGDTIERGLAECHQVAGRFQRIDAGQPFTVVVDYAHTPDSLRALIATA
RALSPKGRVILVAGARGRRDRLKRPELGRAAATADVAILTADNPGDEDPGEIVAQLLAGT
LDVDHKQIIVELDRRGAIGHAIEIAEESDVVLIVGRGHEQTFRVGQTVYRLDDREAAREA
ILAKLAR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgctgacgctgcgtgatctgcatggactcgtgccaagcgctcgtctggtgggcgacccc
tcggtggcgatcgccgacatcacgctggattcacggtcggtctcgcctggagcgatgttc
tgtgcgacgcggggatcgcgtttcgatggtcatgacttcgtcagcgatgcgatcgcgcgt
ggcgccgtcgcgctgctcgtgcagcacgaggtggcactcgacatcccgcaactcgtggtt
ccgtcggtgcggcacgcgatcggcgggctcgtcgcggggttcttcggccgtccatcggag
cggctcgatctcgtcggcatcaccggcaccaatggcaagacgacgacctcgtacttcatc
gactccatcttgagccttgccggccgccgaactggactcatcggcaccatcgaggcgcgc
ttcggggactccaaccgtccgtcgatgttcaccacgcccgaggcgcccgagctgcatcgc
ttgctccggcagatggtcgacgacggagtcgactccgtcgtgatggaggtgtcgtcgcac
ggaatcgaccagcaccgtatcgacggcacgagctttcgaatcggggtcttcaccaacctc
tcgcccgagcaccttgactatcacggcaccatcgagcagtactacgcggccaaggcccag
ctcttcctacccgagcgaaccaagcaggcggtgatcggcaccgacaccgagtggggcgtg
cggctcgcgacccaggttcgcatccctgcggtgacctacgggccagccccgttttcggac
tatcgcgtcgaggacgtgcgctacgacgagtacgggacgatcttcaccgtggtcgtcggc
ggccggcgtcgctggcgtctgcgtgtgcccatctacggcattcacaacgcctacaacgcg
gcagcggcggtggcggtcgcagaagcgctcgggatcgagggcgacacgatcgagcggggg
ctggccgagtgtcatcaggtcgcggggcgcttccagcggatcgacgcgggacaaccgttc
acggtcgtggtcgactacgcgcacacgccggattcgctgcgagcgctcattgcgaccgca
cgagcgctctccccgaagggacgagtgattctggttgcgggggctcggggccgacgtgac
cgcctgaagcgtcccgagctgggacgggccgcagcgaccgccgacgtcgccatcttgacg
gccgacaatcctggcgacgaagacccaggtgagatcgtggcgcagctgctcgcaggcacg
ctcgacgtggaccacaagcagatcatcgtggaactcgatcggcgtggagcgatcggccac
gcgatcgagatcgccgaggagtccgacgtcgtgctcatcgtggggcgcggccacgagcag
accttccgggtgggccagacggtctaccggttggacgatcgcgaggccgcacgtgaggcg
atcctcgcgaagctggctcggtag

DBGET integrated database retrieval system