KEGG   Acidimicrobium ferrooxidans: Afer_1874Help
Entry
Afer_1874         CDS       T00956                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
afo00051  Fructose and mannose metabolism
afo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Afer_1874
Enzymes [BR:afo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Afer_1874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACU54785
UniProt: C7M1N8
Position
1962731..1963396
Genome map
AA seq 221 aa AA seqDB search
MTTWLSRAEAASELVAASALLFEAEVMSRSGHGNLSCRIGDDTILMTSSGSIRNLDPSTL
AVVGLDGTVREGAIAPENAEIIEMHTQVYRLRPELGAIIHTHSPNLTAFAYAHEPLPIRS
EPMLRFGQAVAVPVAPWAPRGSHESVGGIVEALRNAPESQAVLLANHGLLALGAAPTAVA
RLIVALEEAATEERFAAALGGAKDFPADALAKVQASMARVR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatggctttctcgcgccgaagccgcgtcagaactcgtggcggcgagcgcactg
ctgttcgaggcggaggtgatgtcgcgctccggtcacggcaatctctcctgccgcatcggc
gacgacacgatcctcatgacctcgtcgggatcgatccgcaacctcgatccttcgacgctg
gccgtcgtcggactcgacggcaccgttcgcgaaggggcgatcgcgccggagaacgccgag
atcatcgagatgcacacacaggtctaccggcttcgccccgagctcggtgcgatcatccac
acccattcaccgaacctcacggccttcgcctatgcccatgagccgctgcccattcgctcc
gagcccatgcttcggttcggccaggcggtcgcggttcccgtagcgccctgggcgcctcgc
ggatcacacgagtcggtgggcgggatcgtcgaagcactgcggaacgccccagagagtcag
gcggtgctcctcgccaatcacgggttgctggctctcggtgccgcaccaacggcggtggct
cgcctcatcgtcgccctcgaggaagcggcgacggaggagcgcttcgcggcagccctcggt
ggcgccaaggactttcccgccgatgcgctcgccaaggtccaagcctcgatggcgagggta
cggtga

DBGET integrated database retrieval system