KEGG   Acidimicrobium ferrooxidans: Afer_1874Help
Entry
Afer_1874         CDS       T00956                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Afer_1874
Enzymes [BR:afo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Afer_1874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1962731..1963396
Genome map
AA seq 221 aa AA seqDB search
MTTWLSRAEAASELVAASALLFEAEVMSRSGHGNLSCRIGDDTILMTSSGSIRNLDPSTL
AVVGLDGTVREGAIAPENAEIIEMHTQVYRLRPELGAIIHTHSPNLTAFAYAHEPLPIRS
EPMLRFGQAVAVPVAPWAPRGSHESVGGIVEALRNAPESQAVLLANHGLLALGAAPTAVA
RLIVALEEAATEERFAAALGGAKDFPADALAKVQASMARVR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatggctttctcgcgccgaagccgcgtcagaactcgtggcggcgagcgcactg
ctgttcgaggcggaggtgatgtcgcgctccggtcacggcaatctctcctgccgcatcggc
gacgacacgatcctcatgacctcgtcgggatcgatccgcaacctcgatccttcgacgctg
gccgtcgtcggactcgacggcaccgttcgcgaaggggcgatcgcgccggagaacgccgag
atcatcgagatgcacacacaggtctaccggcttcgccccgagctcggtgcgatcatccac
acccattcaccgaacctcacggccttcgcctatgcccatgagccgctgcccattcgctcc
gagcccatgcttcggttcggccaggcggtcgcggttcccgtagcgccctgggcgcctcgc
ggatcacacgagtcggtgggcgggatcgtcgaagcactgcggaacgccccagagagtcag
gcggtgctcctcgccaatcacgggttgctggctctcggtgccgcaccaacggcggtggct
cgcctcatcgtcgccctcgaggaagcggcgacggaggagcgcttcgcggcagccctcggt
ggcgccaaggactttcccgccgatgcgctcgccaaggtccaagcctcgatggcgagggta
cggtga

DBGET integrated database retrieval system