KEGG   Acidimicrobium ferrooxidans: Afer_1911Help
Entry
Afer_1911         CDS       T00956                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
afo00790  Folate biosynthesis
afo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Afer_1911
Enzymes [BR:afo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Afer_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CinA
Motif
Other DBs
NCBI-ProteinID: ACU54816
UniProt: C7M1R9
Position
complement(1999682..2000488)
Genome map
AA seq 268 aa AA seqDB search
MSERRDARIMGIVNVTPDSFSDGGRYFDAARAIEHGLELFAEGADIVDVGGESTRPGAVP
VPETEELRRVLPVVAALAPYGVVSIDTVKPAVARAAVEAGATIVNDVSGRLGPVAAEVGA
VWIAMHAQGDPQTMQVNPTYTDVVGEVSAWLRERRDEARALGVKEVWFDPGIGFGKTVAH
NLALIAHLRQIASLGAPVVVGLSRKSMLAELSRAEPALPPLEREEQSLAAAIWAIEHGAD
VVRVHRVRPIREYLRLAAAMEEAAREWA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcgtcgcgacgctcggatcatggggatcgtcaacgtcacgcccgactccttc
agtgacggcggtcgctacttcgatgcggccagagcgatcgagcacggtctcgaactcttc
gccgagggggccgacatcgtcgacgtgggtggcgagtccacgcggccgggcgcggtgccg
gtgcccgagaccgaggagctccgtcgggtcctgccggtcgtggcggcgctcgctccctac
ggggtcgtctccatcgacacggtcaagcccgccgtcgctcgggcggcggtcgaggcaggc
gcgacgatcgtcaacgacgtgagcggtcgactcggaccggtcgcggctgaggtcggtgcg
gtgtggatcgcgatgcatgcccagggtgacccgcagacgatgcaggtcaacccgacctat
accgacgtggtgggcgaggtgtcggcgtggctcagggagcgacgtgacgaggcgcgtgcg
ctgggcgtgaaggaggtctggttcgatcccgggatcggcttcggcaagacggtcgcgcac
aacctggcgctgatcgcgcaccttcgtcaaatcgcgtccctcggcgcaccggtcgtcgtc
ggcctctcgcgcaagagcatgctggccgagctcagtcgtgccgagcccgcgttgcccccg
ctcgagcgcgaggagcagagcctcgccgcggccatctgggcgatcgagcacggtgcggac
gtggtgcgggtgcaccgagtacggccgatccgtgagtacctgcgtctcgctgcggccatg
gaggaggcggcgcgcgagtgggcctga

DBGET integrated database retrieval system