KEGG   Acidimicrobium ferrooxidans: Afer_1912Help
Entry
Afer_1912         CDS       T00956                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Afer_1912
Enzymes [BR:afo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Afer_1912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2000485..2001057)
Genome map
AA seq 190 aa AA seqDB search
MSAPTNDDARAAVDTLLAWAEATLGATLADDVRTRTPERVVEALAELLGGYRAEPDDPVR
FAPEQRAPVVLDEIRFASLCEHHLLPFTGTVSVEYLPGAGVLGLSAVVREIERHARRLQL
QERLTQEIADAIAKAARARLVRVTVRAEHACIAIRGVRREGVIVTTQALAGREVGSPNAL
AELERGRPPR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaccgacgaacgacgacgctcgcgcggccgtggacacgctgctcgcgtgggcc
gaggccaccctcggtgcgacgctcgccgacgacgtgcgcacgcgcaccccggagcgggtg
gtcgaggcactggccgaactgctcggcgggtatcgggccgagcccgacgatccggtgcgg
ttcgcgcccgagcagcgggctcccgtcgtcctcgacgagatcaggtttgcctcgctgtgt
gagcatcacctcctgccgtttacgggcacggtctcggtggagtatctcccgggagctggg
gtcctcggcctgtcggccgtggtgcgagagatcgagcggcacgctcgtcgcctccagctc
caagaacggctgacgcaggagatcgccgatgcgatcgccaaggcggcccgggcgcgtctc
gtccgtgtcaccgttcgggccgagcacgcctgcatcgccatccggggggtgcgacgcgag
ggcgtgatcgtgacgacccaggcgctggcgggcagggaggtgggcagccccaacgcgctc
gcggagctcgagcgaggacggccgccccgatga

DBGET integrated database retrieval system