KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0425Help
Entry
AFE_0425          CDS       T00810                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00020  Citrate cycle (TCA cycle)
afr00640  Propanoate metabolism
afr00660  C5-Branched dibasic acid metabolism
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
afr01120  Microbial metabolism in diverse environments
afr01130  Biosynthesis of antibiotics
afr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFE_0425 (sucC)
   00640 Propanoate metabolism
    AFE_0425 (sucC)
   00660 C5-Branched dibasic acid metabolism
    AFE_0425 (sucC)
Enzymes [BR:afr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AFE_0425 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACK78337
UniProt: B7J4G8
Position
369644..370807
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKRLLAEEGVPVPRAIPAFSVREAVNQARELGGPAWVVKAQVHAGGRGKAGGV
RMVDSIAQVEKAAQELLGKPLVTAQTGPQGQHVAALLIEEPSRIARELYLALMVDRGQAR
ITFLATREGGVDIEELAASRPEALHRVVVEPSTGFLPFQARQLGFQFGLDAGQVQQLTRI
MQGMYRLAQRLDALMVEINPLAITAEGRLLALDAKVVMDDNALYRHPESDELFDSTQQDG
REITARQFGLNYISLEGNIGCMVNGAGLAMATMDLIKLHGGEPANFLDVGGGAAADKVNQ
AFKLILSDTRVKAILVNIFGGITRCDLLAEGIIQAAAEVGLHLPVVVRLEGTRKEEGMAL
LRESGLSLITADGLTDAAMKAVAAAQG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggccaagcgcctgctcgccgaggaaggggtgccggtgcct
cgcgccattcccgccttctcggtacgggaggccgtcaatcaggcccgtgaactgggtggt
ccggcctgggtcgtcaaagcacaggtgcatgccggtggacgcggcaaggccggtggcgtg
cggatggtggacagcattgcccaggtggaaaaggcggcgcaggagttgctgggcaaaccg
ctggtcacggcgcagaccggtccgcaggggcagcacgtagcggctttgctgatcgaggag
cccagtcgcatcgcccgcgagctttatctggccttgatggtggaccgggggcaggcgcgg
atcacctttctggcgacccgtgaaggcggtgtggacatcgaggagctggcggcctcccgg
cccgaggccctgcaccgggtcgtggtcgagcccagtacgggttttctgccttttcaggcg
cgccagctcggtttccagttcggactggacgccggccaggtgcagcaactcacgcgcatc
atgcagggcatgtatcgcctggcgcaacggctcgatgccctgatggtggaaatcaatccc
ctcgccatcaccgccgaaggcaggctgctggccctggatgccaaggtggtgatggacgac
aacgccctgtaccgccaccccgagtctgatgaactttttgactccacccagcaggacggg
cgcgagattacggcgcggcagttcggactgaattacatctccctggaaggcaatatcggc
tgcatggtcaacggggccgggctggccatggcgaccatggacctgatcaagctgcacggc
ggcgagcccgccaactttctggatgtgggcgggggcgcggccgcggacaaggtcaaccag
gccttcaaactcatcctctcggacacccgggtgaaggccatactggtcaatatcttcggg
ggcatcacccgctgtgatctgctggcggagggcatcatccaggcggcggcggaggtgggt
cttcacctgccggtggtggtgcgtctggagggcacccggaaggaggagggcatggcgttg
ttgcgcgagagcggactgtccctgatcaccgccgatggtctcaccgacgcggcgatgaag
gccgtggcggcggcccaaggctga

DBGET integrated database retrieval system