KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0433Help
Entry
AFE_0433          CDS       T00810                                 

Definition
dioxygenase, ARD/ARD' family
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AFE_0433
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     AFE_0433
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     AFE_0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
376527..377075
Genome map
AA seq 182 aa AA seqDB search
MAALQYAETVQRITDTARIAATLAPLGVTLQAIPVTGAGVAALLTELQPDPEAQAALLTA
LDDVFRRLQRERGYQERDLVVLYPGHPQLAELTARFHRVHTHDDEEVRYIVDGEGVFGFV
LEDGAQVELTVHAGDYVHIPAGVEHWFRLTDAQRIKAVRYFSARGGWTPHYTDRAMRSFP
NP
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcggctttgcaatatgcggaaacggtgcagcggatcacggatacggcgcggatcgcc
gccacgctggcgcccctgggcgttaccttgcaggcgattccggtgaccggggcgggggtc
gcggcgctgctgaccgagctgcaacccgatccggaggcacaggcggcgttgctgacggcc
ctggatgacgtcttccggcgtttgcagcgggagaggggctatcaggagcgggatctggtg
gtgttgtatcccgggcatccgcagttggcggagctcaccgcccgtttccatcgcgtgcat
acccatgacgatgaagaggtgcgctatatcgtggacggggaaggcgttttcggcttcgtt
ctggaagacggcgcgcaagtcgagctgaccgtgcatgcaggggattatgtccatatcccg
gcgggggtggagcactggtttcgtctcacggatgcgcaacggatcaaggcggtgcgctac
ttcagcgcgcgcggcggctggacaccgcattataccgatcgcgccatgcggtctttcccc
aacccatga

DBGET integrated database retrieval system