KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0445Help
Entry
AFE_0445          CDS       T00810                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AFE_0445 (galU)
   00052 Galactose metabolism
    AFE_0445 (galU)
   00500 Starch and sucrose metabolism
    AFE_0445 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AFE_0445 (galU)
Enzymes [BR:afr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AFE_0445 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(385318..386214)
Genome map
AA seq 298 aa AA seqDB search
MAEVRKAVFPVAGLGTRFLPATKASAKEMMPIVDKPLIQYAVEEAIAAGCDQLIFISGRG
KRAIEDHFDVSYELEIELEKRGKADLLKQVQGILPSHVSTIFLRQPYPLGLGHAVLMARP
VVGDEPFAVLLADDLMLSESPVLAQMVEQYRRYQTGILGVEEIPREHSTRYGVVDARPWD
DRIYQVSGIVEKPKPEDAPSNLGVVGRYILPARIFHFLEQTQQGAGGEIQLTDAIAHLLN
ERQVLAYLFSGQRFDCGDKLGYLKATIAFGKLHPEVGADFTRYMDSICEPQASAETLS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtgcgcaaggcagtattccccgtggccggtctgggcacccgttttctcccg
gccaccaaggcgagcgccaaggaaatgatgccgatagtggacaagccgctcattcagtat
gctgtggaggaagccatcgctgcaggctgcgatcaactcattttcatcagcggacgtggc
aagcgtgccatcgaagaccacttcgacgtttcctacgaactggaaatcgagctggaaaaa
cgcggcaaggcggatttgctgaagcaggtacagggcattctgcccagccacgtcagtacc
atttttctgcgccagccctaccctctcggcctcggacatgccgtgctgatggcccgtccg
gtggtgggtgacgaaccctttgcggtcttgctggcggacgatcttatgctgagcgagtct
cctgtgcttgcgcaaatggtggaacagtatcgccgctatcagacaggcatcctcggcgtc
gaagaaatcccgcgagaacattccacccgctatggcgtagtcgatgcgcggccctgggat
gatcgtatctaccaggtcagcggcatcgtcgaaaagcccaaacccgaggacgccccctcc
aatctgggagtggtgggacgctacatcctccccgcgcggatattccactttctggagcag
acccagcagggcgcgggcggtgagattcaactgacggacgccatcgctcacctgttgaat
gaacggcaggtgctggcctatcttttttccgggcagcgctttgactgcggcgacaagctc
ggctatctgaaggcaaccatcgccttcggcaaactccaccccgaggtaggcgccgatttc
acccggtacatggacagcatttgcgagccccaggcgtcggccgagaccctttcgtga

DBGET integrated database retrieval system