KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0463Help
Entry
AFE_0463          CDS       T00810                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:afr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    AFE_0463
Enzymes [BR:afr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     AFE_0463
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     AFE_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403957..404760
Genome map
AA seq 267 aa AA seqDB search
MAELPEIELLRQKLRRNILHKRVGVMQMQNAKGEALPDGAGIKDAALKGRAITDLHRYGQ
YLFLELDRKDILALQLGGELSGELERGPVHGEGGEEPRAALEIQINGQQRLRFQGTQLGN
RLRMLDENSDVDFLTKLGPDPLMVHGEGLGILREALSRRRSALRNILLDDTFAPGIGGIW
ADEILFQARLRPDRTATSLSEEERERFLEQIPKVLDRAVRCQAKTNLLPKTFLTRHREDG
HCPSCGGALETLSVGGKNAMLCPACQS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttgccagaaatagaactgctcagacaaaagctgcggcgcaatatcctgcac
aagcgggtcggcgtcatgcagatgcagaatgccaagggcgaggcacttccggatggtgcc
ggcatcaaagatgccgcactcaaaggcagggccatcaccgacctgcatcgctacggtcaa
taccttttcctggaactggatcgcaaggacatcctcgccctgcagttgggtggtgagctg
agcggcgaactcgaacgcggccctgttcatggggaaggcggggaagagccgcgagcggca
ttggagatacagatcaacggccagcagcgcctgcgttttcaggggacccagttgggtaac
cgcctgcgcatgctggacgaaaacagcgatgtggacttcctcaccaagctcggccctgat
ccactgatggtgcatggggaagggcttggtatattgcgcgaggccctgagccgtcgccgc
agcgccctgcgcaacatcctgctggatgataccttcgcgccgggcatcggcggtatctgg
gcggatgaaatcctttttcaggcccgcctgcgaccggatcgcaccgcgaccagtctcagc
gaagaagagcgcgagcgtttcctggagcagatccccaaggtgctggatcgcgccgtgcgc
tgtcaggcgaagaccaacctgctgcccaagaccttcctcacccgccatcgggaagacggg
cactgcccgagttgcggcggcgcgctggagaccctttcggtggggggtaaaaacgcgatg
ctctgcccagcctgccagtcttga

DBGET integrated database retrieval system