KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0469Help
Entry
AFE_0469          CDS       T00810                                 

Gene name
pcm-2
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
409730..410455
Genome map
AA seq 241 aa AA seqDB search
MAASLLALSPEVGMISPRTRGRMVLRLRAEGIRDERVLDAMNRVPRHRFVAQALAGRAYE
PVSLPIGYGQTISQPWMVARMMEAILEEREVPRRVLEIGTGSAYQTAVLAELGAEVFSIE
RIGPLQERATALLGRLGYRQVHLQHGDGSGGWPEKAPFDAMVITAAVPCALAPLYRQLCA
GGSLVMPVEEGGRQHLQVSHWDGSTARVIALGSCHFVPLLAGTVSVASGECADDKRDWRR
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttcgttgctagccctgagtcctgaagtcggcatgatttccccgcgcacgcgg
ggaagaatggtgctccgtctgcgcgcggaaggcatccgtgatgagcgggtgctggacgcg
atgaaccgggttccgcgtcatcgctttgtcgcccaagcgctggcggggcgggcctatgag
ccggtatcgctgcccatcggttacggacagaccatctcccagccctggatggtggcgcgg
atgatggaagcgattctggaggagcgggaggtgcccaggcgggtcctggagatcggtaca
gggtccgcttaccagaccgccgtgctggcggagctaggggcggaggtcttcagtatcgag
cgtatcggcccgctgcaggaaagggcgaccgcgttgctgggcaggctgggctatcgccag
gtgcacctgcagcacggcgatggcagcggcggctggccggaaaaagccccctttgacgca
atggtcattaccgctgccgtgccctgcgcactggcgcccctttaccgccagttgtgcgcc
ggaggcagtctggtaatgccggtggaggagggggggaggcagcatttgcaggtcagtcat
tgggatggcagcactgcgcgagtgattgccctgggcagttgccattttgtccccttgcta
gcgggtaccgtttctgtggcctcaggagaatgtgcggatgataaacgcgattggagacga
ggatga

DBGET integrated database retrieval system