KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0469Help
Entry
AFE_0469          CDS       T00810                                 

Gene name
pcm-2
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Brite
Enzymes [BR:afr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AFE_0469 (pcm-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 RrnaAD Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ACK78171
UniProt: B7J4L2
Position
409730..410455
Genome map
AA seq 241 aa AA seqDB search
MAASLLALSPEVGMISPRTRGRMVLRLRAEGIRDERVLDAMNRVPRHRFVAQALAGRAYE
PVSLPIGYGQTISQPWMVARMMEAILEEREVPRRVLEIGTGSAYQTAVLAELGAEVFSIE
RIGPLQERATALLGRLGYRQVHLQHGDGSGGWPEKAPFDAMVITAAVPCALAPLYRQLCA
GGSLVMPVEEGGRQHLQVSHWDGSTARVIALGSCHFVPLLAGTVSVASGECADDKRDWRR
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttcgttgctagccctgagtcctgaagtcggcatgatttccccgcgcacgcgg
ggaagaatggtgctccgtctgcgcgcggaaggcatccgtgatgagcgggtgctggacgcg
atgaaccgggttccgcgtcatcgctttgtcgcccaagcgctggcggggcgggcctatgag
ccggtatcgctgcccatcggttacggacagaccatctcccagccctggatggtggcgcgg
atgatggaagcgattctggaggagcgggaggtgcccaggcgggtcctggagatcggtaca
gggtccgcttaccagaccgccgtgctggcggagctaggggcggaggtcttcagtatcgag
cgtatcggcccgctgcaggaaagggcgaccgcgttgctgggcaggctgggctatcgccag
gtgcacctgcagcacggcgatggcagcggcggctggccggaaaaagccccctttgacgca
atggtcattaccgctgccgtgccctgcgcactggcgcccctttaccgccagttgtgcgcc
ggaggcagtctggtaatgccggtggaggagggggggaggcagcatttgcaggtcagtcat
tgggatggcagcactgcgcgagtgattgccctgggcagttgccattttgtccccttgcta
gcgggtaccgtttctgtggcctcaggagaatgtgcggatgataaacgcgattggagacga
ggatga

DBGET integrated database retrieval system