KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0474Help
Entry
AFE_0474          CDS       T00810                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00260  Glycine, serine and threonine metabolism
afr00750  Vitamin B6 metabolism
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
afr01120  Microbial metabolism in diverse environments
afr01230  Biosynthesis of amino acids
Module
afr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFE_0474 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AFE_0474 (thrC)
Enzymes [BR:afr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AFE_0474 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACK79982
UniProt: B7J4L7
Position
414427..415557
Genome map
AA seq 376 aa AA seqDB search
MSRYTGIIDHYRAFLPLAPETPAVSLGEGNTPLIECINLPRQLGLDLRLFLKFEGLNPTG
SFKDRGMAMAVTKAKEDGSEMVICASTGNTSAAAAAYAARAGMRAFVVIPEGKIALGKLS
QAMMHGAMVLQIRGNFDAGMQIVQEVAANAPITLVNSVNPYRLQGQKTAAFEIIEALGEA
PDYHALPVGNAGNITAHWMGYCEATDGRTDKSQPLTASCKFCNGTCSYGHGKAGKRPKML
GFQAAGSAPFIVGHYVKDPETIATAIRIGHPMSWDQAHRVQAESGGWFGSHSDAEILEAQ
RWLAQYEGVFCEPASATSVAGVVAEARAGKIEAGATVVCTLTGHGLKDPDTAIAQGGEVL
TVDASLEAVQRAILDR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttataccggcattatcgaccattaccgcgccttcctgcccctggctcctgaa
accccggcggtgagcctgggtgagggcaatacgccactgatcgagtgtatcaacctgccc
cgccagcttggcctcgatctccgccttttcctcaaatttgagggcctgaatcccaccggc
tccttcaaggaccgtggtatggccatggcggtgaccaaggccaaggaagacggcagcgag
atggtgatctgcgcctccaccggcaacacttcggcggcagcggcggcctatgcggcgcgg
gcgggaatgcgcgccttcgtggtgattccggaaggcaagattgccctcggcaagctctct
caggcgatgatgcatggtgccatggtgttgcagattcgcggcaacttcgatgcgggcatg
cagatcgtccaggaagtggcggccaatgcgccgattaccctggtgaattcggttaaccct
taccgcttgcagggtcagaagacggcggccttcgagattatcgaagcattgggtgaagcg
cccgattatcacgccctgcccgtggggaatgccggcaatatcaccgcccactggatgggc
tattgtgaagccaccgatggacggaccgataagtcccagcccttgaccgcctcctgcaag
ttctgtaatggcacctgtagctacggtcacggtaaggccggaaaacgaccgaagatgctg
ggttttcaggcggcaggcagtgcccccttcatcgtcggccactacgtgaaggaccccgag
accatcgccacggccatccgtatcggccaccccatgtcctgggatcaggcgcatcgggtg
caggcggaaagcggcggctggtttggcagtcatagcgatgccgagattctggaagcgcag
cgctggctggcgcaatatgagggcgttttctgcgaaccggcctcggcgacttcggtggcg
ggggtggttgctgaggcccgcgccggaaaaattgaagccggtgcgacggtagtctgtact
ctcaccgggcatggcctgaaagatcccgataccgccatcgctcagggtggcgaagtgctc
accgtggatgccagtctggaggcggtgcagcgcgccatcctggatcgctga

DBGET integrated database retrieval system