KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1450Help
Entry
AFE_1450          CDS       T00810                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00900  Terpenoid backbone biosynthesis
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
afr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AFE_1450 (dxr)
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AFE_1450 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh Sacchrp_dh_NADP DUF296
Motif
Other DBs
NCBI-ProteinID: ACK78432
UniProt: B7J9P7
Position
1250740..1251921
Genome map
AA seq 393 aa AA seqDB search
MEMTRGICILGATGSIGKSTLDVVSRHPDQFRIVALTGNHRVAEMQLLCQQHHPELVVMA
APEAAQQLRVGLGDAGLKKIQVESGPEALAEAARMSGVDEVMAAIVGAAGLLPTLAAVEA
GKKVYLANKECLVMAGNLFMERVRQHQVTLLPIDSEHNAVFQCFADGKGVRRILLTASGG
PFRTWPAEHLAVVTPDQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFDLPASRIDV
MIHPQSIIHSMVEYVDGSVLAQLGNPDMRTPIAHALAFPERMESGVSSLDLAHGPDLQFE
APDLQRFPCLALAFDALQAGGAAATVLNAANEIAVQAFLEGHLPFLRIAAVVEDTLGELQ
PAAPDHLDDVLAIDQLAREVALRHLARHGSGMQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatgacacgaggcatctgcatactcggggctacgggctccatcggcaagagcacc
ctggatgtggtgtcgcgccaccccgaccaattccggatcgtcgcgcttaccggcaatcac
cgtgtggcagagatgcagttgctgtgtcagcaacatcatcccgagttggtggttatggct
gccccggaagcggcgcagcagttgcgggtggggctaggcgatgccggcctcaagaagatc
caggtagagagtggcccggaggcgcttgccgaagcggcacgtatgtccggcgtcgatgag
gtgatggcagccattgtgggcgccgccggcctgttaccgaccctggccgccgtagaagcc
gggaaaaaggtctatttggccaacaaggaatgtctggtgatggcgggcaacctcttcatg
gagcgtgtgcgacagcatcaggtgacgctgcttcccatcgatagcgagcacaatgctgta
ttccagtgctttgcagatggcaaaggcgtgcgccgtattctgctgacggcttccggagga
ccgttccggacctggccggcggagcatctggcggtggtaacgccggaccaggcctgtgcc
catcccaactgggtcatgggccgaaaaatctccgtagactctgcaaccatgatgaataag
gggctggaggtcatcgaggcgcattggctctttgacctccccgcctcccggatcgacgtg
atgattcatccccagagcatcatccattccatggtggaatatgtggatggctccgtgctg
gcgcaactgggcaaccccgatatgcgcacccccattgcccatgctctggcttttccagag
cgcatggaaagcggggtttcgtctctggatctggcgcatgggccggaccttcagttcgag
gcaccagacttacagcggtttccttgcctggccctcgcttttgatgccctgcaggcaggg
ggagcagcagcgacggtgctgaacgcggcgaatgagattgccgtacaggccttcctggaa
gggcacctgccatttctacgaattgcggccgtcgtcgaagatacccttggtgaattacag
cccgccgccccagaccatctggacgatgtgctggctatcgaccaactggcacgggaagtg
gctctccgccacctggcccggcatggatcgggtatgcagtga

DBGET integrated database retrieval system