KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1807Help
Entry
AFE_1807          CDS       T00810                                 

Definition
carbohydrate kinase, PfkB family
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFE_1807
   01230 Biosynthesis of amino acids
    AFE_1807
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFE_1807
   00030 Pentose phosphate pathway
    AFE_1807
   00051 Fructose and mannose metabolism
    AFE_1807
   00052 Galactose metabolism
    AFE_1807
  Energy metabolism
   00680 Methane metabolism
    AFE_1807
Enzymes [BR:afr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AFE_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1570226..1571185)
Genome map
AA seq 319 aa AA seqDB search
MTENNTRSPSIATLTLNPAVDIAYEVPHLIPDQKSHATSTRYDPGGNGINVARALKELLV
YAHSCCVVAGNIGELLQKLLQHHLDDPHCVHVEGETRVNATILQGDPATQFEITGIGPRV
SEPILAEVRETFLGLCKDGFAVLTGSVPPGVDDHFYGDMVDRVRAGGGQSIVDAHGALLQ
HALPHHPFLIKPNSYELSLLRRRELPTLEDVAKEARAIQREGVQYVCVSLGGDGALLVGP
DGSYFAKAPPIQVKSTVGSGDSMVAGLVAALAHGQSPAEALRLAVACGSGTAARPGTEIF
SHNDLDELLQITEARVLDI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaacaacacccgctccccgtccatcgctaccctcaccctcaacccggccgta
gacatcgcctacgaagtgccgcacctgatcccggaccagaagagccacgccacatccacc
cgctacgatcccggcggtaacggcatcaatgtcgcccgcgccctcaaggagctgctggtc
tacgcccatagttgctgcgtcgtggccggcaatatcggcgaactgctacagaagctgctg
caacatcacctggacgatccccactgcgtgcacgtagagggggaaacccgcgtcaacgcc
accattttgcagggggaccccgccacccagtttgaaatcaccggcatcgggccacgggtt
tcagaacctatcctcgccgaagtccgggaaacctttctgggcctgtgcaaagacggtttc
gcggtactcaccggctccgtcccccctggcgtggatgatcatttctatggagatatggtc
gatcgggtccgcgccggaggcggacaatccattgtcgacgcccatggcgccctcctgcaa
cacgcccttccccatcaccccttcctgatcaaacccaatagctatgagctgtccctcctg
cgtcggcgcgagctccccacgctggaggatgtggcgaaggaggcgcgcgccatacagcgg
gaaggggtgcagtatgtctgtgtatccctggggggcgacggagcactgctggtcgggccc
gatggcagctattttgccaaggcaccccccattcaggtgaagtcgacggtcggctcgggc
gactccatggtcgccggtctcgtcgccgcgctggcccacggccaaagcccggcagaggcc
ctgcgcctggccgtcgcctgcggcagcggcacggctgcccggccgggcaccgagatattc
tcccataatgatctggacgaactgctacagataacggaagcgcgtgtactcgacatctga

DBGET integrated database retrieval system