KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1819Help
Entry
AFE_1819          CDS       T00810                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:afr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1584324..1585472)
Genome map
AA seq 382 aa AA seqDB search
MGKSAVLELAEDLISRPSVTPEDAGCQELMIARLKAVGFRVTRLPANGVENFWAERGGAG
PRLCFAGHTDVVPSGPLAEWQNDPFQPIIRDGMLYGRGAADMKGSLAAMVVAAERFVALH
PAHSGRLAFLITSDEEGIATHGTRHVVDWLREHGETIDWCVVGEPSSEKVLGDVIKNGRR
GSLNGRLTVHGIQGHVAYPDKADNPIHRAFRPLADLVDQSWDAGNDFFPPTRLQFSNIHA
GTGANNVIPGQLQADFNFRFSTESTPESLQAGVHKILDASAMRYTIDWQLSGPPFFTAPG
PLVAATQKALQAVEQRVAQLSTGGGTSDGRFIAQLGGQVVELGPVNATIHKINECVAVAD
LEHLAQIYMEIMVHLLETANGR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaagagcgccgtactggaactggctgaagacctgatttcccgcccttcggtgacc
ccggaggatgcaggctgtcaggaactgatgatcgcccggctgaaggctgtgggttttcgg
gtgacgcgtctgcctgccaacggggtggagaatttctgggcggagcggggtggcgccggc
ccgcgactttgttttgcggggcatacggatgtagtccccagcggcccgctcgcggaatgg
caaaacgacccctttcagccgatcatccgcgacggcatgctctatggacgtggtgctgcc
gacatgaagggcagcctcgccgccatggtggtcgccgcagagcgttttgtcgccctgcat
ccggcgcattccggtcgtctggcctttctgatcacctccgatgaagaaggcatcgccacc
cacggtacccgccatgtggtggactggctgcgggagcatggggagaccatcgactggtgc
gtggtcggcgagccctcctccgaaaaggtgttgggggacgtcatcaaaaatggtcggcgc
ggttcgctgaacgggcgcctgacggtacacggcatccagggccatgtggcttaccctgac
aaggccgataatcccatccaccgcgccttccgcccactcgcggatctcgtggatcagtcc
tgggatgcggggaatgattttttcccgcctacccgcctgcagttctccaatatccacgcg
ggcaccggggccaacaacgtcattcccggccagttgcaggcggattttaattttcgtttt
tccacggagtccacgccggaatctttgcaggcaggggtccacaaaatccttgacgcctcc
gccatgcgctacaccatcgactggcaattgtccggtccgcctttctttacggcaccgggc
cccttggtagctgctacccaaaaggccttgcaagccgtggaacagcgcgtggcccaactg
tccaccggcggtggcacctcggacgggcgcttcattgcccagttgggcgggcaagtcgta
gaactcgggcccgtcaatgccaccatccacaagatcaacgaatgcgttgccgtcgccgat
ctggagcatctggcgcaaatctatatggagatcatggtgcatctgctggagaccgcgaat
ggccgttag

DBGET integrated database retrieval system