KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1921Help
Entry
AFE_1921          CDS       T00810                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:afr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1673115..1673714
Genome map
AA seq 199 aa AA seqDB search
MADVPSMDALVALLRRLPGIGPRSAQRISYELLVRKRDLMPQLAAAFQQAHAVVRFCERC
NNLSEAPLCAVCRSEHRDRSILCVVESPADLRAIEDTGVFVGEFFVLMGHLSPLDGIGPE
ALHIDRLSARLGETDLQEVIFATNPTLEGEATAQFLAGLVPDGVTISRIARGVPVGGELE
YVDRSTLGRALHGRRLLDE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgttccgagtatggacgccctggtggcactgctacgccgcctaccgggtatt
ggcccgcgttcggcgcaacggatcagctatgagttgctggtgcgtaagcgcgatctcatg
ccgcaactcgccgcagcctttcagcaagcccacgcggtggtccgtttttgtgagcgctgc
aacaacctgagcgaagcgccattgtgtgccgtctgtcgttccgaacaccgggaccgttcc
attttgtgcgtggtggaatcgcccgctgatctgcgtgcaatcgaggatacgggggtgttc
gtcggcgaatttttcgtattgatggggcatttgtcgcccctggacggcatcggtcccgaa
gccctgcatatcgaccgcctcagcgcgcgactgggtgaaacagacttgcaggaagtgatt
tttgcgaccaatcctaccctggaaggagaggctacagcccagtttctcgctggactggtt
cctgacggtgtcaccatcagtcgtatcgcgcggggggtgccggtgggtggtgaactggaa
tatgtcgatcgcagcaccctcgggcgcgccttgcatggtcgtcgcttgctcgacgaataa

DBGET integrated database retrieval system