KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2068Help
Entry
AFE_2068          CDS       T00810                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:afr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:afr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1817963..1818781)
Genome map
AA seq 272 aa AA seqDB search
MSRLAGLFVQLRDAGRAALIPFMTAGDPSLTATVPLMHALVAAGADAIELGMPFSDPMAD
GPSIQRASERALARGVKLRMVLEWVREFRTTNSHTPVILMGYLNPVEAMGITSFAEAAAT
AGVDGVILVDLTPEEGRGEAVVLRQRGIDPIFLLAPTSGPERVATVRSMGSGFVYYVSLR
GITGAAQADWAEVLERVQHLHRQLGLPVAIGFGIRDAATVARVATGADAVVVGSALVDQL
AACATDQEAIAAAIRFVEPLAQAVRSTERRGA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctcgccgggctgtttgtccaactccgggatgcgggtcgcgccgccctcatt
cctttcatgacggcgggtgacccatccctgaccgcgaccgtgcccctgatgcacgcgctg
gtcgccgcgggggccgatgccatcgaactggggatgcccttttccgaccccatggccgat
ggtcccagcatccagcgcgccagtgagcgggcgctggcgcgaggggtgaagctgcgcatg
gtcctggagtgggtgcgcgaattccgcacgaccaacagtcacacgcccgtcattctcatg
ggttatctgaatccggtggaagccatgggtataacctcgttcgccgaggctgccgcgacg
gcgggggtggacggtgtcattctggtggatctgactccggaggaggggcgaggtgaagcc
gtcgttctccgccagcggggtatcgatcccattttcctgctggcgccgaccagcgggccg
gaacgcgtggcgaccgtccgcagtatgggcagtggttttgtatattatgtatctctgcgc
ggtattaccggtgcagcccaggcggactgggcggaagttctggagcgggtacagcacctg
caccggcaactgggcctgcccgtggccatcggttttggcattcgcgatgcagcgacggta
gcgcgggtggcgaccggggccgacgcggtggtcgtcggcagtgcactggtcgatcaactg
gcggcgtgtgcgacggatcaggaagccattgcggcggccatccgctttgtcgagccgctg
gcccaggccgtccggagtacggaaaggagaggcgcatga

DBGET integrated database retrieval system