KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2088Help
Entry
AFE_2088          CDS       T00810                                 

Definition
zinc-binding alcohol dehydrogenase family protein (EC:1.-.-.-)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AFE_2088
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFE_2088
  Lipid metabolism
   00071 Fatty acid degradation
    AFE_2088
  Amino acid metabolism
   00350 Tyrosine metabolism
    AFE_2088
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AFE_2088
   00626 Naphthalene degradation
    AFE_2088
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AFE_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1839676..1840683
Genome map
AA seq 335 aa AA seqDB search
MHAMVLEEVGRPLVPTELPRPRPQPGQVLVKILACGVCRTDLHVVDGELPNPKLPLVPGH
EVVGQIESVGSPDISLQTGQMVGIPWLAWTCGACEYCRAGRENLCDQARFHGYTVDGGYA
EYMVADARYCFPLPDIYANPEGAPLLCAGLIGFRALRFAAGRRRLGLYGFGAAAHLLIQV
ARYQGMEVYAFTRPGDSKAQDLAIKLGAVWVGGSEVLPPQPLDAAILFAPVGALIPIALQ
AVKKGGVVISAGIHMSDIPAFPYSLLWEERQVRSVANLTRKDAEDYFPLARRVPVQSHIT
TYPLAMANVALADLRGGAVHGAAVLVMGAWQERET
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccatggttctggaagaggtgggtaggcctttggtgcccactgaattgccgcga
ccgcggccacagccgggccaggtcctggtaaaaatactggcgtgcggagtgtgccgtacc
gatctgcatgtagtggacggtgaattgcccaaccccaaactaccactcgttcccggccat
gaagtagtcggccagatagaatcggtgggaagccccgatatttccttacagaccggtcag
atggtgggaattccctggctcgcatggacctgcggtgcctgcgaatattgtcgagcagga
cgggagaatctttgtgaccaggcgcgttttcatggctacaccgtggatggcggttacgcc
gagtatatggtcgccgatgcgcgttactgcttccctcttccagacatttacgccaatccg
gaaggtgccccgctgttgtgtgcggggctcatcggctttcgggccttacgttttgccgcg
ggaagacgacgcctgggtctttatggattcggcgctgccgcgcatttactgattcaggta
gcgcgttatcaaggcatggaggtctatgcatttacccgcccgggcgatagcaaggcacag
gatctagcgatcaaattgggggctgtgtgggtaggtggatcggaggtcctgccgccacaa
ccgctggatgcggcaattttgtttgcaccggttggagccctgatacctattgctcttcag
gcggtcaagaaagggggtgttgtgatcagtgcggggattcacatgtcggatatcccagct
ttcccctattccttactctgggaggagcgacaggtgcgatcggttgccaacctgacgcgc
aaagatgccgaggactatttcccactggcacgacgggtcccggtgcaaagccatatcacg
acgtatcctttggccatggcgaatgtggcattggcggatttgagaggtggcgcggtccac
ggtgccgcggtactggttatgggggcatggcaggaacgcgagacgtga

DBGET integrated database retrieval system