KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2088Help
Entry
AFE_2088          CDS       T00810                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00010  Glycolysis / Gluconeogenesis
afr00071  Fatty acid degradation
afr00350  Tyrosine metabolism
afr00625  Chloroalkane and chloroalkene degradation
afr00626  Naphthalene degradation
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
afr01120  Microbial metabolism in diverse environments
afr01130  Biosynthesis of antibiotics
afr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFE_2088
  Lipid metabolism
   00071 Fatty acid degradation
    AFE_2088
  Amino acid metabolism
   00350 Tyrosine metabolism
    AFE_2088
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AFE_2088
   00626 Naphthalene degradation
    AFE_2088
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AFE_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ACK78636
UniProt: B7J4U8
Position
1839676..1840683
Genome map
AA seq 335 aa AA seqDB search
MHAMVLEEVGRPLVPTELPRPRPQPGQVLVKILACGVCRTDLHVVDGELPNPKLPLVPGH
EVVGQIESVGSPDISLQTGQMVGIPWLAWTCGACEYCRAGRENLCDQARFHGYTVDGGYA
EYMVADARYCFPLPDIYANPEGAPLLCAGLIGFRALRFAAGRRRLGLYGFGAAAHLLIQV
ARYQGMEVYAFTRPGDSKAQDLAIKLGAVWVGGSEVLPPQPLDAAILFAPVGALIPIALQ
AVKKGGVVISAGIHMSDIPAFPYSLLWEERQVRSVANLTRKDAEDYFPLARRVPVQSHIT
TYPLAMANVALADLRGGAVHGAAVLVMGAWQERET
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccatggttctggaagaggtgggtaggcctttggtgcccactgaattgccgcga
ccgcggccacagccgggccaggtcctggtaaaaatactggcgtgcggagtgtgccgtacc
gatctgcatgtagtggacggtgaattgcccaaccccaaactaccactcgttcccggccat
gaagtagtcggccagatagaatcggtgggaagccccgatatttccttacagaccggtcag
atggtgggaattccctggctcgcatggacctgcggtgcctgcgaatattgtcgagcagga
cgggagaatctttgtgaccaggcgcgttttcatggctacaccgtggatggcggttacgcc
gagtatatggtcgccgatgcgcgttactgcttccctcttccagacatttacgccaatccg
gaaggtgccccgctgttgtgtgcggggctcatcggctttcgggccttacgttttgccgcg
ggaagacgacgcctgggtctttatggattcggcgctgccgcgcatttactgattcaggta
gcgcgttatcaaggcatggaggtctatgcatttacccgcccgggcgatagcaaggcacag
gatctagcgatcaaattgggggctgtgtgggtaggtggatcggaggtcctgccgccacaa
ccgctggatgcggcaattttgtttgcaccggttggagccctgatacctattgctcttcag
gcggtcaagaaagggggtgttgtgatcagtgcggggattcacatgtcggatatcccagct
ttcccctattccttactctgggaggagcgacaggtgcgatcggttgccaacctgacgcgc
aaagatgccgaggactatttcccactggcacgacgggtcccggtgcaaagccatatcacg
acgtatcctttggccatggcgaatgtggcattggcggatttgagaggtggcgcggtccac
ggtgccgcggtactggttatgggggcatggcaggaacgcgagacgtga

DBGET integrated database retrieval system