KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2136Help
Entry
AFE_2136          CDS       T00810                                 

Gene name
pcm-1
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Brite
Enzymes [BR:afr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AFE_2136 (pcm-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1889451..1890104
Genome map
AA seq 217 aa AA seqDB search
MDFDILRRTMIDTQIRTWDVLDPRVLNAVAQVKREDFVAAPYRHLAFADFTLPLAHGETM
WSPKMEARVVQELDLREQDRVLEIGTGSGYLTALMAQLAGMVHSVEDRADLSRTAADHLR
TQGVQNACLHIGDGSEGWADNAPYDAICITGSLPVLPDIFKQQLTVGGRLVAILGTGPAM
GVRRILHSRPGVFESSELFETEIPPLRHQPLPAHFVF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggactttgacatcctccgccgtaccatgatcgacacccagatccgcacctgggatgtg
ctcgacccccgtgtgctgaacgccgtggcgcaggtgaagcgcgaggacttcgtagccgct
ccctaccggcacctggctttcgctgattttaccctgcctctggcgcacggtgaaaccatg
tggtcgccgaaaatggaggctcgagtcgtgcaggagctggatttgcgggaacaggaccgg
gtactggagatcggcaccggaagcggctatctgaccgccctgatggcacaacttgcggga
atggtacacagcgtcgaagaccgcgccgatctctcccggacagcggcagatcatctgcgc
acacaaggtgttcagaatgcctgtctgcacattggcgacggctccgagggctgggcggac
aatgccccatatgatgccatctgcatcaccggctccctgccggtactgccggatatcttc
aaacagcaactgacggtcggtggacggctggtcgccattctcggtaccggtccggccatg
ggggtgcggcgcatcctgcactcccggccgggtgtttttgagagctcggagctttttgag
acagagatcccgcctttgcgtcatcagccgctaccggcccactttgtgttctga

DBGET integrated database retrieval system