KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2203Help
Entry
AFE_2203          CDS       T00810                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AFE_2203 (holC)
   00240 Pyrimidine metabolism
    AFE_2203 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AFE_2203 (holC)
   03430 Mismatch repair
    AFE_2203 (holC)
   03440 Homologous recombination
    AFE_2203 (holC)
Enzymes [BR:afr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AFE_2203 (holC)
DNA replication proteins [BR:afr03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AFE_2203 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1952562..1952987
Genome map
AA seq 141 aa AA seqDB search
MPVASFYTLPPTLLTAHEQRRGMCRVIAKVWQVMGEADILCPDTEAGQTLDDLLWTFQAG
AFVPHARGAGEPVRIHENGAWPLQGKALVLCGLDKLPAPLPPCERLIDFIPVAEQLRGFA
RERYRQLKNAGFTMQVHPLEA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgtcgcctcgttttataccctgcccccgacactgcttaccgcgcacgaacagcgg
cgcggcatgtgccgggtgattgccaaggtgtggcaggtcatgggagaagcagatatcctg
tgtccggatacggaggccggacagaccctggatgacctgctctggacctttcaggcggga
gctttcgtgccccatgcccggggtgcaggagaaccggtacgcatccacgagaacggtgca
tggcccttgcagggcaaggcgctggtgctctgcgggctggacaaattgccagcgcccctc
cccccctgcgagcggctcatcgacttcattccggtcgcagagcaactgcgcggcttcgcc
agagaacgatacagacaattaaagaacgcaggattcaccatgcaggtgcatcccctggaa
gcctga

DBGET integrated database retrieval system