KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2224Help
Entry
AFE_2224          CDS       T00810                                 

Definition
glycosyl hydrolase family protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFE_2224
Enzymes [BR:afr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AFE_2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1976273..1978633
Genome map
AA seq 786 aa AA seqDB search
MGNPSKAPAAAWRHPVWSTARKSCVGTALGSGKIWFTTGRGIVTEVFYPRIDIPQIRDLG
FIVADDQGFWQELKALPEPRLEMEDPLVPLPIIHHHHDRFDFTLKICADPERDVLLLDFH
LEGDAALRPYLLCSARLGEDAENNCAWVGDWEGRPVLWAEQGPFGLALTCRNADGYPALE
RCTVGEVGASDLWQDFHQNGRMQWAYQEAGPGEVALAGRLPRQGTLALGLGTSKEAAATN
AWSSLAEGFQSRAADYSAGWNAWHQRHPTHHCVSKLPAAAKALYARSTNILKVHEDRTFP
GAMVASLSVPWGESSDSRGGYHLVWSRDLVESAGALLALGAATEARHVLTYLISTQQADG
HWLQNQWLGGKPFWQGVQLDETGFPVLLASALREAQMLENVAVTDMITRALHFIVHEGPV
TGQDRWEEDGGVNLFTLAVAIAALVEGAGFLGGKAGDCALMLADYWNARLEEWTFAHDTD
LARRFQVAGHYVRIIPEDILVQDGAQKEWVLIKNRAHDPHLSAGEQVANDFLQLVRYGLR
SADDPHVTASVKVMDGLLRTDTPCGPVWHRYNGDGYGEHADGSPFDGTGIGRGWPLLVGE
RGHYALAAGEDAVPYINAMAAMTGNSGLLPEQIWESDAIPEKGLFPGHPSGSAMPLVWAH
GEFIKLCHSAAQGRPVDRPAQTWKRYQGKVPKIDYRIWRLRQRPRQLPAGQELRLLLRAP
FTVHWGSNGWQAIQDTESEDWGLGHVATLPVQKLRVGDSVQFTILWRDSGDWQGEDFHID
IVGGGA
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaacccaagcaaagcgcccgctgccgcttggcgccaccccgtctggtccaccgcc
cggaaatcctgcgtgggcacggcgctgggcagcggaaaaatctggtttaccacgggccgg
gggattgtcaccgaagtcttttacccgcgtatcgacatccctcagattcgcgacctcggc
ttcatcgttgccgatgatcaggggttctggcaggaactgaaggccctgccagaaccccga
ctggaaatggaggaccccctcgttcctctgcccatcatccaccatcatcacgaccgcttc
gacttcaccctgaaaatctgcgcagacccggaacgggatgtgctcctgctcgacttccat
ctggagggcgatgccgcgctgcggccttatctgctctgctccgcacgtctcggtgaggat
gccgaaaacaactgcgcgtgggtaggtgattgggaaggccggccagtactctgggcagaa
cagggaccttttggcctggcgctcacctgccgcaacgccgacggctatccggcactggaa
cgctgcacggtgggcgaagtgggtgccagtgatctctggcaggattttcatcagaacgga
cggatgcagtgggcatatcaggaggccggaccaggtgaggtggccttggcgggtcgtctg
ccacggcagggcaccctggccctgggtcttggcaccagcaaggaagccgccgccaccaac
gcctggtcctccctggccgagggctttcagagccgcgcggcggattacagcgccggctgg
aatgcctggcaccaacgccatcccacccaccactgtgtcagcaaactgccggcggcggct
aaagccctgtacgctcgctccaccaacattctcaaggtacatgaggatcgtaccttcccc
ggcgcgatggtggccagtctctcggtgccctggggggagtccagcgacagtcgcggcggc
tatcatctggtttggtcccgagatctggtggagagcgcaggggccctgctcgccctcggg
gccgccaccgaagcacgacacgtactgacctatctcatcagcacccaacaggccgacggg
cactggttacagaatcaatggctgggcggcaaacccttctggcaaggggtgcagctcgat
gaaacgggattcccggtgctcctcgcctcggcattgcgcgaggcgcagatgctggagaac
gtagcggtcaccgacatgatcacccgtgccttgcactttatcgtccacgaggggccggtg
actgggcaggaccgctgggaggaagatggcggcgtcaatctgttcaccctcgcagtggcc
atcgccgcgctggtggagggtgccggcttcctgggcggcaaggccggtgactgtgccctg
atgctggccgattactggaatgcacgactggaggaatggacctttgcgcacgataccgac
cttgccagacgctttcaggtagccggccactacgtccgcatcatcccggaggatatcctg
gtgcaggatggcgcccagaaggagtgggtactgatcaagaaccgggctcatgatccgcac
ttgtccgctggcgaacaggtcgccaacgacttcctgcaactggtgcgttacggtctgcgc
agcgcggacgatccgcacgtcaccgcctcggtcaaagtcatggatggactgctccgaaca
gacactccctgcggcccggtctggcaccgctacaatggcgacggttacggggaacatgcc
gatggcagcccctttgacggtaccggcatcggtcgtggctggcctttgctggtaggggaa
cggggtcattacgccctcgccgctggcgaagacgccgtgccctacatcaacgccatggcg
gccatgacaggcaacagtggactactgccggaacagatctgggagtccgacgccataccg
gagaagggcctgttccccggccaccccagcggctcggccatgcccttggtctgggcccac
ggtgagttcatcaagctgtgccacagcgctgcgcagggccgtcccgtggaccgcccggcg
cagacctggaagcgctatcagggcaaagtcccgaagatcgactaccggatctggcgtctg
cgccagcggccgcgtcaactgcccgcaggacaggaactgcggctgttgttgcgggcgcct
ttcaccgtacactggggcagcaacggctggcaggcgatacaggataccgagtcggaagac
tggggtctcggccatgtcgctaccctgccggtacagaaattgcgggtcggggacagcgta
cagttcaccatcctctggcgcgacagcggcgactggcagggcgaggattttcatatcgat
attgtcggaggtggcgcatga

DBGET integrated database retrieval system