KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2414Help
Entry
AFE_2414          CDS       T00810                                 

Definition
hypothetical protein
Orthology
K09803  
hypothetical protein
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2161717..2161998
Genome map
AA seq 93 aa AA seqDB search
MRFTWNDKKRQTNLRDHRVDFADAVGVFFDDCALTTEDVDAEGEQRLVTMGRDFLDRVLI
VVYTERGGDEIRLISARKASPGERKAYAGGANP
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgagattcacctggaacgacaaaaagcggcaaaccaacctgcgcgatcatcgcgtggac
tttgccgatgccgtcggggtcttttttgatgactgcgccctgaccacggaggatgtggat
gccgaaggtgagcagcgtctggtgacgatggggcgggacttcttggatcgagtactgatc
gtggtgtacaccgagcgcggtggagatgaaatacgcctcatatccgcccgtaaagccagc
ccaggagaacgcaaagcatatgcaggaggtgcgaacccatga

DBGET integrated database retrieval system