KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2464Help
Entry
AFE_2464          CDS       T00810                                 

Gene name
proB-1
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:afr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2197673..2198641)
Genome map
AA seq 322 aa AA seqDB search
MHSVVPDRAALQQRARRWVIKIGSSLLTQDGQRLDLSAMQKLVQQILRLRAEDIEVVLVS
SGSVSAGKCHLGWAQKMTTAEERQAAASVEQSALIHAYENLLAEGGTHCGQILLTRDNFR
DRKRLKKTRSAIEMLLRMQMLPIINENDAIVDLDNALGNNDHLAALVSNVWHADLMVLLT
DQSGLFTADPRARPDAEMITEGMAGDPRYEHMAGGSGGTVGTGGMLTKIHAATHAARSGA
TTLIADGRIPDVLLRLHKGALLGTFLRSGKFDRKLRRDAWTRLQIHHGQQWVIHPVRRVK
DEVVAFYSETPPFTAIPIFNGQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcattccgtagtgcccgaccgggcagcgctacagcagcgcgcacgccgctgggttatc
aagatcgggagcagtctgctgactcaagacggccaacgactggatttgtcggccatgcag
aaacttgtgcagcaaatactgcgacttcgcgccgaagatattgaggtcgtattagtttcc
tccggttccgtcagtgccggcaaatgtcacctgggatgggcccagaagatgaccaccgcc
gaagagcgtcaggcggcggccagcgtggagcaatccgccctgattcatgcttatgagaat
ctcctggccgagggagggacgcattgcgggcaaatactgctgacgcgcgataacttcaga
gatcggaagcgcctcaagaagactcggtccgccatcgaaatgctcttgagaatgcagatg
ttgcccattatcaatgagaacgatgcgatcgtcgatctggataatgctctgggcaacaac
gaccatttggccgccctggtcagcaacgtctggcatgccgacctgatggtattgctgact
gatcaatcagggctatttacagcggacccgcgcgcacggcctgatgccgaaatgatcacg
gaaggtatggcgggtgacccacggtatgagcatatggcgggtggaagcggtggcaccgtg
ggtaccggcgggatgctcaccaaaatacacgccgccacccatgcggcgcgctctggtgcg
accacgctcattgccgatggacgaattccggatgtgctcctgcgcttgcacaagggggca
cttttggggacatttctgcgttctggaaaattcgaccggaaattgcgtcgggatgcctgg
acacgtcttcagatccaccacggccaacagtgggtgatccatcccgtgcgccgggtaaaa
gatgaggtggtggctttttattcggaaacgccaccttttaccgcaataccaatattcaac
ggccaataa

DBGET integrated database retrieval system